DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14036 and CG32625

DIOPT Version :9

Sequence 1:NP_608903.1 Gene:CG14036 / 33735 FlyBaseID:FBgn0031677 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_727732.1 Gene:CG32625 / 318128 FlyBaseID:FBgn0052625 Length:144 Species:Drosophila melanogaster


Alignment Length:89 Identity:30/89 - (33%)
Similarity:42/89 - (47%) Gaps:13/89 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FEYGICPYDKSHRILLFRMPKHLIKCEKNYCGPPLQTCKYNATHR--VQDMEKHLKECDYYLRSI 66
            :||..||...||.::||:||.||..|.|.:....|..|.||.||.  :.|:.:|:.:|..|||..
  Fly     8 YEYVNCPNSSSHLVMLFKMPYHLPLCAKKFPSDELARCPYNRTHMYPIADIYEHIIKCPSYLREE 72

  Fly    67 ENQAVQIALRSRIPPKQEDGHDVD 90
            .:.           ..:||..|.|
  Fly    73 SHS-----------DAKEDAKDCD 85

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14036NP_608903.1 zf-U11-48K 8..30 CDD:283028 10/21 (48%)
zf-U11-48K 40..59 CDD:283028 7/20 (35%)
CG32625NP_727732.1 zf-U11-48K 43..66 CDD:283028 7/22 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40293
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.