powered by:
Protein Alignment CG14036 and Gtsf2
DIOPT Version :9
Sequence 1: | NP_608903.1 |
Gene: | CG14036 / 33735 |
FlyBaseID: | FBgn0031677 |
Length: | 93 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_808299.1 |
Gene: | Gtsf2 / 223927 |
MGIID: | 2652828 |
Length: | 154 |
Species: | Mus musculus |
Alignment Length: | 56 |
Identity: | 20/56 - (35%) |
Similarity: | 30/56 - (53%) |
Gaps: | 4/56 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 ICPYDKSHRILLFRMPKHLIKCEKN--YCGPPLQTCKYNATH--RVQDMEKHLKEC 59
:||||.:|||...|:..||..|:|. .....:..|||||.| .::.:::|...|
Mouse 8 LCPYDPNHRIPASRLQYHLASCKKKNPKIAKKMANCKYNACHVVPIKRLKEHEANC 63
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4376 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1359124at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X10473 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
4 | 3.820 |
|
Return to query results.
Submit another query.