DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14036 and GTSF1L

DIOPT Version :9

Sequence 1:NP_608903.1 Gene:CG14036 / 33735 FlyBaseID:FBgn0031677 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_789761.1 Gene:GTSF1L / 149699 HGNCID:16198 Length:148 Species:Homo sapiens


Alignment Length:89 Identity:30/89 - (33%)
Similarity:43/89 - (48%) Gaps:10/89 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 YGICPYDKSHRILLFRMPKHLIKCEKNYCGP----PLQTCKYNATH--RVQDMEKHLKECDYYLR 64
            :.|||||..|||.|.|...||..|.:.  .|    .:.||||||.|  .::::|:|...| ....
Human     6 FEICPYDPHHRIPLSRFQYHLASCRRK--NPKKAKKMATCKYNACHVVPIKNLEEHEAVC-VNRS 67

  Fly    65 SIENQAVQIALRSRIPPKQEDGHD 88
            ::|.:..:..|:.. ||..|...|
Human    68 AVEEEDTENPLKVS-PPSSEQNDD 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14036NP_608903.1 zf-U11-48K 8..30 CDD:283028 12/21 (57%)
zf-U11-48K 40..59 CDD:283028 9/20 (45%)
GTSF1LNP_789761.1 zf-U11-48K 8..30 CDD:310105 12/21 (57%)
zf-U11-48K 41..63 CDD:310105 9/21 (43%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 67..99 6/25 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4376
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 46 1.000 Inparanoid score I5492
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X10473
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.