DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14036 and LOC11176039

DIOPT Version :10

Sequence 1:NP_608903.1 Gene:CG14036 / 33735 FlyBaseID:FBgn0031677 Length:93 Species:Drosophila melanogaster
Sequence 2:XP_061506846.1 Gene:LOC11176039 / 11176039 VectorBaseID:AGAMI1_007548 Length:209 Species:Anopheles gambiae


Alignment Length:53 Identity:23/53 - (43%)
Similarity:32/53 - (60%) Gaps:2/53 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CPYDKSHRILLFRMPKHLIKCEKNYCGPPLQTCKYNATHRV--QDMEKHLKEC 59
            |||:|||.||..|..||||||.:.:....:..|.:|::|.|  |:|:.|...|
Mosquito    17 CPYNKSHTILAQRFVKHLIKCRRQHPNAKIAICPFNSSHHVNEQEMKVHTTTC 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14036NP_608903.1 zf-U11-48K 8..30 CDD:461603 14/20 (70%)
zf-U11-48K 38..59 CDD:461603 7/22 (32%)
LOC11176039XP_061506846.1 None

Return to query results.
Submit another query.