DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14036 and gtsf2

DIOPT Version :9

Sequence 1:NP_608903.1 Gene:CG14036 / 33735 FlyBaseID:FBgn0031677 Length:93 Species:Drosophila melanogaster
Sequence 2:NP_001120225.1 Gene:gtsf2 / 100145274 XenbaseID:XB-GENE-5780436 Length:278 Species:Xenopus tropicalis


Alignment Length:57 Identity:27/57 - (47%)
Similarity:35/57 - (61%) Gaps:4/57 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CPYDKSHRILLFRMPKHLIKCEKN--YCGPPLQTCKYNATHRV--QDMEKHLKECDY 61
            |||||:|.|...|.|.||:||.:|  .....|.||.|||.|||  |:::.|:..|:|
 Frog     9 CPYDKNHLIRPSRFPYHLVKCRENNRAAAKELATCPYNARHRVPKQELDLHMASCEY 65

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14036NP_608903.1 zf-U11-48K 8..30 CDD:283028 12/20 (60%)
zf-U11-48K 40..59 CDD:283028 10/20 (50%)
gtsf2NP_001120225.1 zf-U11-48K 7..30 CDD:283028 12/20 (60%)
zf-U11-48K 41..64 CDD:283028 10/22 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1359124at2759
OrthoFinder 1 1.000 - - FOG0006211
OrthoInspector 1 1.000 - - otm47477
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.