powered by:
Protein Alignment CG14036 and gtsf2
DIOPT Version :9
Sequence 1: | NP_608903.1 |
Gene: | CG14036 / 33735 |
FlyBaseID: | FBgn0031677 |
Length: | 93 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001120225.1 |
Gene: | gtsf2 / 100145274 |
XenbaseID: | XB-GENE-5780436 |
Length: | 278 |
Species: | Xenopus tropicalis |
Alignment Length: | 57 |
Identity: | 27/57 - (47%) |
Similarity: | 35/57 - (61%) |
Gaps: | 4/57 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 9 CPYDKSHRILLFRMPKHLIKCEKN--YCGPPLQTCKYNATHRV--QDMEKHLKECDY 61
|||||:|.|...|.|.||:||.:| .....|.||.|||.||| |:::.|:..|:|
Frog 9 CPYDKNHLIRPSRFPYHLVKCRENNRAAAKELATCPYNARHRVPKQELDLHMASCEY 65
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1359124at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0006211 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
otm47477 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 3.010 |
|
Return to query results.
Submit another query.