DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment senju and SLC35B1

DIOPT Version :10

Sequence 1:NP_608902.1 Gene:senju / 33734 FlyBaseID:FBgn0031676 Length:388 Species:Drosophila melanogaster
Sequence 2:XP_006721695.1 Gene:SLC35B1 / 10237 HGNCID:20798 Length:393 Species:Homo sapiens


Alignment Length:70 Identity:18/70 - (25%)
Similarity:30/70 - (42%) Gaps:9/70 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 PAFLY---------CLYNNLAFVNLATFDPTTYYLLLQLRVVVTGILFQIIFKKYLSQRQWISLI 146
            ||.:|         .|..:..|:.:..|.|.|..::...|...|.:...|:|...:|..||:..:
Human   308 PAIIYNILLFGLTSALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGTV 372

  Fly   147 LLTLG 151
            |:.||
Human   373 LVFLG 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
senjuNP_608902.1 Nuc_sug_transp 44..346 CDD:398009 18/70 (26%)
SLC35B1XP_006721695.1 UAA 53..380 CDD:462479 18/70 (26%)

Return to query results.
Submit another query.