DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and AKR2B

DIOPT Version :9

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_179331.1 Gene:AKR2B / 816246 AraportID:AT2G17390 Length:344 Species:Arabidopsis thaliana


Alignment Length:308 Identity:66/308 - (21%)
Similarity:117/308 - (37%) Gaps:48/308 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GTAAILGDAELLELLLQSCEEPELNVF------------HQSNTDSLEIERTPEGMEKLEWVDEF 97
            |.|.||.|..:.||..|..::|..|..            |:....:.:.::..:.|:::....||
plant    55 GMAGILNDPSIKELAEQIAKDPSFNQLAEQLQRSVPTGSHEGGLPNFDPQQYMQTMQQVMENPEF 119

  Fly    98 ENSAENGAGSGEEDSQLYQYYAKTFETTGEFISSQCC---VSCREHDPH----LYDADVATPLHY 155
            ...||....:..:|.|:..:    .|..|...:|:..   ::..:.||.    |.:.|...|...
plant   120 RTMAERLGNALVQDPQMSPF----LEALGNPAASEQFAERMAQMKEDPELKPILAEIDAGGPSAM 180

  Fly   156 AAYWGHEECVRILLEHNAPINVLNNDGYAPLHLGAGFA-GVTELLIKHGALVNAKTLSDGKTALH 219
            ..||.                  :.|..|.|....|.| |..:.:.....  .|:...:.::.:|
plant   181 MKYWN------------------DKDVLAKLGEAMGIAVGADQTVAAEPE--EAEEGEEEESIVH 225

  Fly   220 MAIESKCAESARLLLQTNININDTDDDGETPLMAAIACSMLDVAEELVKRGARINIQDKQNHTAL 284
            ........|..:..|.:..|.::.|.:|.|.|..|.....:..|:.|:..||..|..||..:|.|
plant   226 QTASLGDVEGLKAALASGGNKDEEDSEGRTALHFACGYGEVRCAQVLLDAGANANAIDKNKNTPL 290

  Fly   285 QYAVRGRHTQMAKLLLERGA----RRLASQHLLHLAVESNVKELVELL 328
            .||......:...||||.||    :.:.:::.:.:|..:|..::|:||
plant   291 HYAAGYGRKECVSLLLENGAAVTQQNMDNKNPIDVARLNNQLDVVKLL 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 31/149 (21%)
ANK repeat 151..179 CDD:293786 3/27 (11%)
Ank_2 153..244 CDD:289560 13/91 (14%)
ANK repeat 181..210 CDD:293786 7/29 (24%)
ANK repeat 213..244 CDD:293786 4/30 (13%)
Ank_2 218..304 CDD:289560 24/85 (28%)
ANK 241..362 CDD:238125 27/92 (29%)
ANK repeat 246..277 CDD:293786 9/30 (30%)
ANK repeat 279..304 CDD:293786 8/24 (33%)
Ank_4 311..362 CDD:290365 5/18 (28%)
SOCS_box 518..574 CDD:284857
AKR2BNP_179331.1 EBP50_C <2..>49 CDD:286142
ANK 225..338 CDD:238125 29/112 (26%)
Ank_2 225..316 CDD:289560 26/90 (29%)
ANK repeat 252..283 CDD:293786 9/30 (30%)
ANK repeat 285..316 CDD:293786 10/30 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.