DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and CG41099

DIOPT Version :9

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001015359.1 Gene:CG41099 / 3355072 FlyBaseID:FBgn0039955 Length:1124 Species:Drosophila melanogaster


Alignment Length:301 Identity:72/301 - (23%)
Similarity:140/301 - (46%) Gaps:63/301 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 ILLEHNAPINVLNNDGYAPLHLGA--GFAGVTELLIKHGALVNAKTLSDG-KTALHMAIESKCAE 228
            |.|...|.::.:|..|...||:.|  ....:.:.||.:||..|.|.:..| |:|||:|:|:...:
  Fly   454 IFLADFADLDHINFRGLTALHIAALNNMPNLVKKLIVNGASSNLKHIDCGLKSALHIAVEANAID 518

  Fly   229 SARLLLQT-----NININDTDDDGETPLMAAIACSMLDVAEELVKRGARINIQDKQNHTALQYAV 288
            :....::.     :|:.|..|.:|::||...::.....:...|::.|:.:|.::|.|.:.|..::
  Fly   519 ALEAFVELKNKSHDIDFNCQDINGDSPLSLCLSLKRTTLVPTLIRGGSDVNGKNKNNLSPLHQSI 583

  Fly   289 RGRHTQMAKLLLERGARRLA-SQHL---LHLAVESNVKELVELLLQYGESLSVWNLKNFTPIMLA 349
            :...:.::..|||:||...| :::|   |.|:::.::.|:|:.|.:.|.:||: |....:|:..|
  Fly   584 KNEDSDISLFLLEQGADITALTENLDSALDLSIKHDLSEVVDALCRRGIALSI-NKNGESPLWSA 647

  Fly   350 IHRGRHEMLEYLLNVAEEQRKLGLYSDVHDEGLVLFAVQQNFWVKEFSRILRVLLAKSPSARNDF 414
            :.:|..::.:.|:       :.|:.:|..|||                          |      
  Fly   648 LEKGYEDVAKILV-------RHGIDTDCWDEG--------------------------P------ 673

  Fly   415 YDSCAPTIVCGLIYCHTPLSRAINLHRLEVAEFLIHEGCNL 455
             :.|..|:          |.|||:.::..||.|||...|:|
  Fly   674 -EGCRQTL----------LHRAIDENKESVAIFLIQSQCDL 703

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 33/140 (24%)
ANK repeat 151..179 CDD:293786 3/11 (27%)
Ank_2 153..244 CDD:289560 23/84 (27%)
ANK repeat 181..210 CDD:293786 9/30 (30%)
ANK repeat 213..244 CDD:293786 9/36 (25%)
Ank_2 218..304 CDD:289560 19/90 (21%)
ANK 241..362 CDD:238125 30/124 (24%)
ANK repeat 246..277 CDD:293786 6/30 (20%)
ANK repeat 279..304 CDD:293786 5/24 (21%)
Ank_4 311..362 CDD:290365 13/53 (25%)
SOCS_box 518..574 CDD:284857
CG41099NP_001015359.1 BTB 67..164 CDD:279045
BTB 75..166 CDD:197585
ANK 252..385 CDD:238125
ANK repeat 291..322 CDD:293786
ANK repeat 325..362 CDD:293786
Ank_2 330..431 CDD:289560
ANK 463..595 CDD:238125 30/131 (23%)
ANK repeat 468..501 CDD:293786 10/32 (31%)
Ank_2 473..572 CDD:289560 25/98 (26%)
ANK repeat 503..539 CDD:293786 9/35 (26%)
ANK 536..660 CDD:238125 30/124 (24%)
ANK repeat 541..572 CDD:293786 6/30 (20%)
ANK repeat 574..637 CDD:293786 17/63 (27%)
Ank_2 579..670 CDD:289560 23/98 (23%)
ANK repeat 639..670 CDD:293786 6/37 (16%)
Ank_2 644..752 CDD:289560 22/110 (20%)
ANK repeat 672..721 CDD:293786 15/75 (20%)
ANK 721..843 CDD:238125
ANK repeat 723..752 CDD:293786
ANKYR 752..977 CDD:223738
ANK repeat 754..786 CDD:293786
ANK 820..944 CDD:238125
ANK repeat 822..855 CDD:293786
ANK repeat 857..888 CDD:293786
ANK 885..1017 CDD:238125
ANK repeat 890..921 CDD:293786
ANK repeat 923..955 CDD:293786
ANK repeat 996..1021 CDD:293786
FYVE_ANFY1 1054..1116 CDD:277267
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24198
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.