DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and ASB14

DIOPT Version :10

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001136205.2 Gene:ASB14 / 142686 HGNCID:19766 Length:587 Species:Homo sapiens


Alignment Length:211 Identity:49/211 - (23%)
Similarity:82/211 - (38%) Gaps:54/211 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 SFIP-PTQQLYAVDPNLKMLIDARPQRIIYNKASSTALGVEVSINYESLYIFATEELIIAGRCLE 183
            |.|| ||....:| |...:.|...|...:.|.::.:.|..:|| ..|......:.|..:||    
Human   292 SSIPSPTTPAPSV-PTELVTISTPPGETVVNTSTVSDLEAQVS-QMEKALSLGSLEPNLAG---- 350

  Fly   184 DYKLISQVDIL---PWDLLS-------KLLSNIPLE-------IALKSPIIA-PIFRMNATPTFN 230
              :::::|..|   |..||:       |::..|.|:       |:|.||.:| .:.|:||: .||
Human   351 --EMVNRVSKLLHSPPALLAPLAQRLLKVVDAIGLQLNFSSTTISLTSPSLALAVIRVNAS-NFN 412

  Fly   231 HTIEPNKQPYCLLATELFIE-----------TLSKSQTNQTTASKEGIQPNAKVNIIVNERAPDR 284
            .|....:.|..|   ::.:|           ||..|..|...|:...:....:.|.         
Human   413 TTTFAAQDPTNL---QVSLETPPPENSIGAITLPSSLMNNLPANDVELASRIQFNF--------- 465

  Fly   285 WIGFNPSVIYQDTATE 300
               |....::||.:.|
Human   466 ---FETPALFQDPSLE 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANKYR 141..362 CDD:440430 41/189 (22%)
ANK repeat 151..179 CDD:293786 5/27 (19%)
ANK repeat 181..210 CDD:293786 8/45 (18%)
ANK repeat 213..244 CDD:293786 11/31 (35%)
ANK repeat 246..277 CDD:293786 7/41 (17%)
ANK repeat 279..304 CDD:293786 4/22 (18%)
SOCS_box 517..573 CDD:462192
ASB14NP_001136205.2 ANKYR 78..351 CDD:440430 17/66 (26%)
ANK 1 81..111
ANK repeat 82..114 CDD:293786
ANK repeat 116..147 CDD:293786
ANK 2 116..145
ANK repeat 149..180 CDD:293786
ANK 3 149..178
ANK repeat 182..213 CDD:293786
ANK 4 182..211
ANK repeat 215..246 CDD:293786
ANK repeat 248..277 CDD:293786
ANK 6 248..277
ANK 7 281..310 7/18 (39%)
ANK 8 313..342 6/29 (21%)
ANK repeat 316..353 CDD:293786 8/43 (19%)
Ank_2 319..413 CDD:463710 25/101 (25%)
ANK repeat 355..385 CDD:293786 8/29 (28%)
ANK 9 355..384 7/28 (25%)
ANK 10 385..414 10/29 (34%)
ANK repeat 387..413 CDD:293786 9/26 (35%)
ANK 11 416..449 6/35 (17%)
ANK repeat 416..446 CDD:293786 5/32 (16%)
SOCS_ASB14 529..585 CDD:239700
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.