DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9121 and ASB10

DIOPT Version :9

Sequence 1:NP_608901.1 Gene:CG9121 / 33732 FlyBaseID:FBgn0031675 Length:600 Species:Drosophila melanogaster
Sequence 2:NP_001135931.2 Gene:ASB10 / 136371 HGNCID:17185 Length:467 Species:Homo sapiens


Alignment Length:481 Identity:113/481 - (23%)
Similarity:162/481 - (33%) Gaps:177/481 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   145 YDADVATPLHYAAYWGHEE--------------------------------CVRILLEHNAPINV 177
            |:.::.||||.||..||.|                                ||.:||...|..|:
Human   112 YEEELTTPLHVAASRGHTEVLRLLLRRRARPDSAPGGRTALHEACAAGHTACVHVLLVAGADPNI 176

  Fly   178 LNNDGYAPLHL--GAGFAGVTELLIKHGALVNAKTLSDGKTALHMAIESKCAESARLLLQTNINI 240
            .:.||..||||  |.|.....|||::.||.|:.::..:.:|.||:|......|.|.|||:.....
Human   177 ADQDGKRPLHLCRGPGTLECAELLLRFGARVDGRSEEEEETPLHVAARLGHVELADLLLRRGACP 241

  Fly   241 NDTDDDGETPLMAA--IACSMLDVAEELVKRGARINIQDKQNHTALQYAVRGRHTQMAKLLLERG 303
            :..:.:|.|||:||  :.|..:..||                      |...|..|:..|||..|
Human   242 DARNAEGWTPLLAACDVRCQSITDAE----------------------ATTARCLQLCSLLLSAG 284

  Fly   304 ARRLAS----QHLLHLAVESNVKELVELLLQYGESLSVWNLKNFTPIMLAIH-------RGRHEM 357
            |...|:    |..||||.......:|||||..|.|.:..:....||:..|:.       :....:
Human   285 ADADAADQDKQRPLHLACRRGHAAVVELLLSCGVSANTMDYGGHTPLHCALQGPAAALAQSPEHV 349

  Fly   358 LEYLLNVAEEQRKLGLYSDVHDEGLVLFAVQQNFWVKEFSRILRVLLAKSPSARNDFYDSCAPTI 422
            :..|||                .|.|      ..|.....::|            :.:.:|..||
Human   350 VRALLN----------------HGAV------RVWPGALPKVL------------ERWSTCPRTI 380

  Fly   423 VCGLIYCHTPLSRAINLHRLEVAEFLIHEGCNLAQICREHVVNELRSNCTPTRLAFARLLCNAGF 487
                                   |.|::. .::.|:..|.|     ...||..|           
Human   381 -----------------------EVLMNT-YSVVQLPEEAV-----GLVTPETL----------- 405

  Fly   488 QFPHKHRPLPKDWPPARLEFEREMCLLGTQPRSLQSLARLEIRRSLLRCLQTRPEVQERYLPTQE 552
               .||:           .|...:..|..||||||.|:|..:|..|                   
Human   406 ---QKHQ-----------RFYSSLFALVRQPRSLQHLSRCALRSHL------------------- 437

  Fly   553 RSSLGRIVDEFAIPATLKRYLS-DFD 577
            ..||.:.:....:|..|.|||. ||:
Human   438 EGSLPQALPRLPLPPRLLRYLQLDFE 463

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9121NP_608901.1 ANK 151..300 CDD:238125 51/184 (28%)
ANK repeat 151..179 CDD:293786 15/59 (25%)
Ank_2 153..244 CDD:289560 36/124 (29%)
ANK repeat 181..210 CDD:293786 14/30 (47%)
ANK repeat 213..244 CDD:293786 9/30 (30%)
Ank_2 218..304 CDD:289560 23/87 (26%)
ANK 241..362 CDD:238125 33/133 (25%)
ANK repeat 246..277 CDD:293786 9/32 (28%)
ANK repeat 279..304 CDD:293786 6/24 (25%)
Ank_4 311..362 CDD:290365 14/57 (25%)
SOCS_box 518..574 CDD:284857 15/55 (27%)
ASB10NP_001135931.2 ANK 1 115..144 9/28 (32%)
Ank_4 117..168 CDD:316185 11/50 (22%)
ANK repeat 118..145 CDD:293786 9/26 (35%)
ANK 2 147..176 5/28 (18%)
ANK 148..256 CDD:238125 34/107 (32%)
ANK repeat 148..178 CDD:293786 6/29 (21%)
ANK repeat 180..212 CDD:293786 14/31 (45%)
ANK 3 180..209 14/28 (50%)
ANK 213..>358 CDD:238125 45/182 (25%)
ANK repeat 214..245 CDD:293786 9/30 (30%)
ANK 4 214..243 9/28 (32%)
ANK repeat 247..324 CDD:293786 30/98 (31%)
ANK 5 247..289 17/63 (27%)
ANK 6 293..322 12/28 (43%)
ANK 7 326..361 8/56 (14%)
ANK repeat 326..358 CDD:293786 6/47 (13%)
SOCS 421..>439 CDD:321974 10/36 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 104 1.000 Inparanoid score I4955
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.