DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Col4a1 and Col4a4

DIOPT Version :9

Sequence 1:	NP_723044.1	Gene:	Col4a1 / 33727	FlyBaseID:	FBgn0000299	Length:	1779	Species:	Drosophila melanogaster
Sequence 2:	NP_001008333.1	Gene:	Col4a4 / 301562	RGDID:	1305355	Length:	159	Species:	Rattus norvegicus

Alignment Length:	139	Identity:	60/139 - (43%)
Similarity:	77/139 - (55%)	Gaps:	24/139 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly    71 KNCTAGYAGCVPKCIAEKGNRGLPGPLGPTGLKGEMGFPGMEGPSGDKGQKGD---PGPYGQRGD 132
            :||:      |.:|..|||:||.||||||.|..|.:|.||..|..|:||.:||   |||.|::||
  Rat    42 RNCS------VCQCFPEKGSRGHPGPLGPQGPIGPLGPPGPIGIPGEKGLRGDSGLPGPPGEKGD 100

  Fly   133 KGERGSPGLHGQAGVPGVQGPAGNPGAPGINGKDGCDGQDGIPGLEGLSGMPGPRGYAGQLGSKG 197
            ||..|.||.      |||.|..|:||.||..||         ||::|.:|..|..||.|:.|:.|
  Rat   101 KGPTGVPGF------PGVDGVPGHPGPPGPRGK---------PGMDGYNGSRGDPGYPGERGAPG 150

  Fly   198 EKGEPAKEN 206
            ..|.|.:.:
  Rat   151 PGGPPVRHH 159

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Col4a1	NP_723044.1	Collagen	104..161	CDD:189968	28/59 (47%)
		Collagen	322..380	CDD:189968
		Collagen	413..465	CDD:189968
		Collagen	499..561	CDD:189968
		Collagen	574..632	CDD:189968
		Collagen	657..714	CDD:189968
		Collagen	765..824	CDD:189968
		Collagen	854..911	CDD:189968
		Collagen	884..943	CDD:189968
		Collagen	923..982	CDD:189968
		Collagen	1028..1085	CDD:189968
		Collagen	1229..1287	CDD:189968
		Collagen	1318..1376	CDD:189968
		Collagen	1399..1458	CDD:189968
		Collagen	1477..1534	CDD:189968
		C4	1555..1662	CDD:128421
		C4	1663..1777	CDD:128421
Col4a4	NP_001008333.1	None
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	139	1.000	Domainoid score	I4671
eggNOG	1	0.900	-	-		E33208_3BAFZ
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	1	1.050	1348	1.000	Inparanoid score	I128
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0000443
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24023
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	5	5.050