DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vkg and Col4a4

DIOPT Version :9

Sequence 1:NP_001260071.1 Gene:vkg / 33726 FlyBaseID:FBgn0016075 Length:1940 Species:Drosophila melanogaster
Sequence 2:NP_001008333.1 Gene:Col4a4 / 301562 RGDID:1305355 Length:159 Species:Rattus norvegicus


Alignment Length:133 Identity:61/133 - (45%)
Similarity:73/133 - (54%) Gaps:18/133 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 GKIC---NTTLCDCKGIKGRMGAPGPIGVPGLEGPAGDIGPPGRAGPLGEKGDVGEYGEQGEKGH 91
            |..|   |.::|.|...||..|.|||:|.   :||.|.:||||..|..||||..|:.|..|..|.
  Rat    36 GSPCGGRNCSVCQCFPEKGSRGHPGPLGP---QGPIGPLGPPGPIGIPGEKGLRGDSGLPGPPGE 97

  Fly    92 RGDIGPKGEMGYPGIMGKSGEPGTPGPRGIDGCDGRPGMQGPSGAPGQNGVRGPPGKPGQQGPPG 156
            :||.||.|..|:||:.|..|.||.||||      |:|||.      |.||.||.||.||::|.||
  Rat    98 KGDKGPTGVPGFPGVDGVPGHPGPPGPR------GKPGMD------GYNGSRGDPGYPGERGAPG 150

  Fly   157 EAG 159
            ..|
  Rat   151 PGG 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vkgNP_001260071.1 Collagen 60..119 CDD:189968 30/58 (52%)
Collagen 102..152 CDD:189968 24/49 (49%)
Collagen 277..334 CDD:189968
Collagen 534..593 CDD:189968
Collagen 814..871 CDD:189968
Collagen 957..1014 CDD:189968
Collagen 990..1049 CDD:189968
Collagen 1070..1128 CDD:189968
C4 1515..1624 CDD:128421
C4 1625..1737 CDD:128421
Col4a4NP_001008333.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BAFZ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000443
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24023
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.