DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vkg and AT1G64455

DIOPT Version :9

Sequence 1:NP_001260071.1 Gene:vkg / 33726 FlyBaseID:FBgn0016075 Length:1940 Species:Drosophila melanogaster
Sequence 2:NP_001321480.1 Gene:AT1G64455 / 28717395 AraportID:AT1G64455 Length:212 Species:Arabidopsis thaliana


Alignment Length:269 Identity:79/269 - (29%)
Similarity:96/269 - (35%) Gaps:99/269 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   346 GPPGIYDPSLTKSLPGPIGSQGDIGPPGEQGPPGLPGKPGRRGPIGLAGQSGDPGLNGSRGPPGR 410
            ||.....|....:.|.|  |.|.:.||    |.|:||.||                    |||  
plant    41 GPTRFPYPKPGFAYPSP--SVGPVPPP----PNGVPGNPG--------------------GPP-- 77

  Fly   411 SERGEAGDYGFIGPPGPQGPPGEAGLPGRYGLHGEPGQNVVGPKGEPGLNGQPGLEGYRGDRGEV 475
                         .||..|.|...||||:.|     |...:|..|.||..|     |:.|:.||.
plant    78 -------------IPGNPGGPMLLGLPGKTG-----GFGFLGITGAPGFLG-----GFIGNSGEP 119

  Fly   476 GLPGDKGLPGEGYNIVGPPGSQGPPGFRGLPGDDGYNGLRGLPGEKGLRGDDCPVCNAGPRGPRG 540
            |..|..|.||.       ||:.|.|||.|..|..|:....|.||..                  |
plant   120 GFLGIIGAPGF-------PGNSGEPGFLGKLGGPGFPEKSGEPGFP------------------G 159

  Fly   541 QEGDTGYPGSHGNRGAIGLTGPRGVQGLQGNPGRAGHKGLPGPAGIPGEPGKVGAAGPDGKAIEV 605
            :.||:||||.:|..|.:|:|...|                 || ||.||.|...|     :.:|:
plant   160 KSGDSGYPGKYGESGFLGVTVKSG-----------------GP-GIIGESGITAA-----ETVEI 201

  Fly   606 GSLRKGEIG 614
            .....||||
plant   202 AEEEGGEIG 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vkgNP_001260071.1 Collagen 60..119 CDD:189968
Collagen 102..152 CDD:189968
Collagen 277..334 CDD:189968
Collagen 534..593 CDD:189968 19/58 (33%)
Collagen 814..871 CDD:189968
Collagen 957..1014 CDD:189968
Collagen 990..1049 CDD:189968
Collagen 1070..1128 CDD:189968
C4 1515..1624 CDD:128421
C4 1625..1737 CDD:128421
AT1G64455NP_001321480.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D63831at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100768
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.