DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and BTI3

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_198975.1 Gene:BTI3 / 834162 AraportID:AT5G41600 Length:257 Species:Arabidopsis thaliana


Alignment Length:207 Identity:50/207 - (24%)
Similarity:94/207 - (45%) Gaps:34/207 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   414 LIYWRDVKKSGIVFGAGLITLAAISSFSVISVF-----AYLSLLTLFGTVAFRIYKSVTQAVQKT 473
            :..||:.|.||.|.|      |..:|:.:..:|     |:|....:|...|..::.:....:.|:
plant    71 IFLWRNKKVSGGVLG------AVTASWVLFELFEYHLLAFLCHFAIFALAALFLWSNACTFIHKS 129

  Fly   474 N----EGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVF 534
            .    |.|..:|.:          :|.::|:.: .||..::.||.:...:|:...|.....|||.
plant   130 TPHIPEVHIPEDPI----------LQLVSGLRI-EINRGLTLLRNIASGKDVKKFILVIAGLWVL 183

  Fly   535 TYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTH----LDLVRSKLTEITDKI-RVAIPIGN 594
            :.:|:.:|.:||...|.|.|||:|.:||..:..:|.:    :..::.:...:.:|: |..|   :
plant   184 SIIGSCYNFLTLFYTATVLLFTIPVLYEKYEDKVDAYGEKAMREIKKQYAVLDEKVLRKVI---S 245

  Fly   595 KKPEAAAESEKD 606
            |.|..|...:||
plant   246 KIPRGALNKKKD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 42/173 (24%)
BTI3NP_198975.1 Reticulon 68..224 CDD:396837 42/169 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3611
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm2472
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.