DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and AT4G01230

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001328823.1 Gene:AT4G01230 / 827950 AraportID:AT4G01230 Length:244 Species:Arabidopsis thaliana


Alignment Length:237 Identity:54/237 - (22%)
Similarity:102/237 - (43%) Gaps:43/237 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 EPKPEPPKPKVEPAKPKVVP----------VAPVESTQPQPKIASVEEIFCKYGLDAWFKPERLH 408
            |.|.|...|..||....:||          .:..:|.:|...:.....|:..:|.:   :|  :|
plant     3 EEKLEIVGPLEEPLMGNIVPEEINGLDSLTSSDSDSEKPDSPVPINAPIYRMFGRE---RP--IH 62

  Fly   409 -----PQVESLIYWRDVKKSGIVFGAGLITLAAISSFSVISV---FAYLSLLTLF--GTVAFRIY 463
                 .:...::.|||.|          :||..:|:.:||.:   |....|||..  |::.|.:.
plant    63 MVLGGGKPADVLLWRDKK----------VTLGLLSAVTVIWLLFGFGGRRLLTSLCRGSILFLLL 117

  Fly   464 KSV-TQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKF 527
            ..: :.|:.|:.|.       .:|:.:..:.:...|......:|...:.||.:.|..||.:.:..
plant   118 SFLWSNALNKSPEN-------MMDIYIPEKPLLQAASAMTFELNCAFATLRSIALERDIKNFVMA 175

  Fly   528 GVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSID 569
            .:.||:.:.:|.||:.::|:.:.||.:.|:|.:||..:..||
plant   176 VIGLWLVSVIGNWFSFLSLLYICFVLIHTVPMLYEKYEDEID 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 40/165 (24%)
AT4G01230NP_001328823.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3611
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.