DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and BTI2

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_192861.1 Gene:BTI2 / 826724 AraportID:AT4G11220 Length:271 Species:Arabidopsis thaliana


Alignment Length:287 Identity:64/287 - (22%)
Similarity:117/287 - (40%) Gaps:53/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   354 EPKPEPPKPKVEPAKPKVVPVAPVES----------------------TQPQPKIASVEEIFCKY 396
            |.|.|...|.::||    |.|...||                      .:.:.|.:|......|.
plant     4 EHKHEESSPNLDPA----VEVVERESLMEKLSEKIHHKGDSSSSSSSDDENEKKSSSSSPKSLKS 64

  Fly   397 GLDAWFKPER-LHP-----QVESLIYWRDVKKSGIVFGAGLI--TLAAISSFSVISVFAYLSLLT 453
            .:...|..|| :|.     :...:..|:|.|.||.|||...:  .|..:..:.::::..::.::.
plant    65 KVYRLFGRERPVHKVLGGGKPADIFMWKDKKMSGGVFGGATVAWVLFELMEYHLLTLLCHVMIVA 129

  Fly   454 LFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLV 518
            |  .|.| ::.:.|..:.|:....|       ::.:..|.:..:|......||..||.||.:...
plant   130 L--AVLF-LWSNATMFIHKSPPKIP-------EVHIPEEPLLQLASGLRIEINRGISSLREIASG 184

  Fly   519 EDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTE-- 581
            .||...:.....|||.:.:|..::.:||..:|.|.|||:|..|:..:..:|::.:...::|.:  
plant   185 RDIKKFLSAIAGLWVLSILGGCYSFLTLAYIALVLLFTVPLFYDKYEDKVDSYGEKAMAELKKQY 249

  Fly   582 --ITDKIRVAIPIGNKKPEAAAESEKD 606
              :..|:...||.|..|     :.:||
plant   250 AVLDAKVFSKIPRGPLK-----DKKKD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 39/165 (24%)
BTI2NP_192861.1 Reticulon 85..241 CDD:396837 39/165 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3611
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
54.770

Return to query results.
Submit another query.