DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and AT3G61560

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001319815.1 Gene:AT3G61560 / 825329 AraportID:AT3G61560 Length:253 Species:Arabidopsis thaliana


Alignment Length:238 Identity:58/238 - (24%)
Similarity:96/238 - (40%) Gaps:42/238 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   378 ESTQPQPKIASVEEIFCKYGLDAWFKPERLHPQV-----ESLIYWRDVKKSGIVFGAG------- 430
            |..:|:...|...:|:..:|.:   ||  :|..:     ..:..|||.|.|..|.|..       
plant    35 EHEKPESPSALKAKIYRLFGRE---KP--VHKVLGGGLPADVFLWRDKKLSASVLGVATAIWVLF 94

  Fly   431 -LITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKV 494
             |:....:|....|.:||..:|..|....||         :.||....|       ::.:..|..
plant    95 ELVEYHFLSLVCHILIFALAALFLLSNAHAF---------MNKTPPKIP-------EIHIKEEHF 143

  Fly   495 QNIAGVAVAHINGFISELRRLFLVEDI--IDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTL 557
            ..|.......:|.....||.:.|..|:  ...:.||  ||:.:.||.|||.:|||.:.||.|.|:
plant   144 LMIVSALRNELNQAFVILRSIALGRDLKKFLMVVFG--LWIISVVGNWFNFLTLVYICFVVLHTV 206

  Fly   558 PKVYENNKQSIDTHLDLVRSKLTE----ITDKIRVAIPIGNKK 596
            |.:||.::..:|...:....:|.:    ..:|:...:|:.:.|
plant   207 PMLYEKHEDKVDPVAEKTLKELKKHYMVFDEKVLSKLPVASLK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 46/178 (26%)
AT3G61560NP_001319815.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3611
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.