DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and AT3G18260

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_566604.1 Gene:AT3G18260 / 821354 AraportID:AT3G18260 Length:225 Species:Arabidopsis thaliana


Alignment Length:212 Identity:44/212 - (20%)
Similarity:92/212 - (43%) Gaps:51/212 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 QVESLIYWRDVK-KSGIVFGAGLI-TLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQK 472
            :|..::.||:.| .:.:|.|..:: .|..:..::.|::..:.|:.::   :.|.|:.:.:     
plant    38 KVADILLWREPKIAATLVIGVSILWFLMEVVEYNFITLICHASMTSM---LFFFIWSTAS----- 94

  Fly   473 TNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLF------LVEDIIDSIKFG--- 528
                    |:|..:..|..|.|.:         .....:|.|.|      ::..::| :..|   
plant    95 --------DFLNWERPLIPEVVLD---------ESSFKQLARSFHVRFNQILTKLLD-VACGRDP 141

  Fly   529 -------VILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTEITDKI 586
                   :.|::.:.:|.:||.:.|:.:.|||:.|||.:||..:..:||....:..|:.::..|:
plant   142 PLFFLTTISLYIVSIIGTYFNFVNLLFIGFVSMQTLPVMYEMYEDDVDTAAGKLMRKMKKLYKKV 206

  Fly   587 RV----AIPIG---NKK 596
            ..    .||.|   |||
plant   207 DTNVLSKIPRGTVKNKK 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 36/181 (20%)
AT3G18260NP_566604.1 Reticulon 39..195 CDD:280592 36/181 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 65 1.000 Domainoid score I3611
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.