DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and AT2G43420

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_565998.1 Gene:AT2G43420 / 818943 AraportID:AT2G43420 Length:561 Species:Arabidopsis thaliana


Alignment Length:210 Identity:39/210 - (18%)
Similarity:78/210 - (37%) Gaps:51/210 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 QVESLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAY-------------LSLLTLFGTVAFR 461
            :|..::.||:.||:.:             ||.|:::|.|             ..||.:|....:.
plant   378 KVADILLWRNEKKTFV-------------SFLVLNLFYYWFFFSGNTFTSSAAQLLFIFAVALYG 429

  Fly   462 IYKSVTQAV--QKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDS 524
            : ..|...:  .:.|:..|::      ..:|...|::::...|...|..:...:.|....|.|..
plant   430 V-SFVPSKIFGFQVNKIPPWR------FEISESAVRDLSSDIVVVWNQGVRSFKSLSSGGDWIKF 487

  Fly   525 IKFGVILWVFTYV-----GAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTEITD 584
            .|....|::...:     .|:.  .|::..:|...|    :||..:..:   ..|.|..:..:|.
plant   488 FKIAGSLYLLKLIVSRSLAAFL--FTVMSFSFTGFF----IYEQYELEL---YHLARIFVECLTF 543

  Fly   585 KIRVAIPI--GNKKP 597
            ..|:.||:  .:.||
plant   544 IKRMVIPVSDASSKP 558

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 31/183 (17%)
AT2G43420NP_565998.1 3b-HSD-NSDHL-like_SDR_e 14..354 CDD:187673
Reticulon 379..537 CDD:367092 33/186 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.