DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and 3BETAHSD/D2

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_180194.2 Gene:3BETAHSD/D2 / 817166 AraportID:AT2G26260 Length:564 Species:Arabidopsis thaliana


Alignment Length:279 Identity:56/279 - (20%)
Similarity:110/279 - (39%) Gaps:74/279 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   362 PKVEPAKPKVVPVA-PVESTQPQPKIASVEEIFCKYG----------LDAWFKPERLHP------ 409
            |::.|::.:::..: ..:||:.:.::.....:..:.|          |.|..:.:|..|      
plant   314 PQLTPSRVRLLSCSRTFDSTKAKDRLGYAPVVPLQEGIRRTIDSFSHLTAGSQSKREGPSKASRI 378

  Fly   410 ----QVESLIYWRDVKKSGIVF-------------GAGLITLAAISSFSVISVFAYLSLLTLFGT 457
                :|...:.|:|:|::.|..             |:.::| |...:..|.|||     |.|.|.
plant   379 LGGGKVADTLLWKDLKQTLIAIFILISIYYNFVATGSTVVT-ALSKALLVASVF-----LFLHGI 437

  Fly   458 VAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDII 522
            :..:|:....:.: ..::.|..||... ||:||          .::..|..:..||.|....|..
plant   438 LPEKIFGYTVEKI-PASQFHLSKDSSH-DLSLS----------VISSWNTTVKALRSLCQGNDWS 490

  Fly   523 DSIKFGVILWVFTYVGA------WFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRS---- 577
            ...|...:|...:..||      :..|:.:..|||:       |||..:|.||:.:...:|    
plant   491 FFFKVVFVLLALSLAGAISLHSIFVIGLPIAFLAFL-------VYEKKEQEIDSIVVSFKSFACK 548

  Fly   578 KLTEITDKIRVAIPIGNKK 596
            ..:::.:|:     .|:||
plant   549 HKSDVYEKL-----FGSKK 562

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 42/182 (23%)
3BETAHSD/D2NP_180194.2 3b-HSD-NSDHL-like_SDR_e 11..358 CDD:187673 5/43 (12%)
3Beta_HSD 13..288 CDD:279420
Reticulon 384..539 CDD:280592 42/179 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.