DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and AT2G20590

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_179649.2 Gene:AT2G20590 / 816582 AraportID:AT2G20590 Length:431 Species:Arabidopsis thaliana


Alignment Length:399 Identity:89/399 - (22%)
Similarity:142/399 - (35%) Gaps:126/399 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   231 SDTESPSVSYTPSPAKKPIVDALKDQDNEKFISSEDLASDFKEEPRSAPTPAP-APAPILDAAPA 294
            |:|:|.|              .|:|..|...:|.:.:.|       |..||.| :|.|:.|.   
plant    10 SNTKSAS--------------RLQDSSNPPNLSLDLVLS-------SPNTPNPSSPVPLRDI--- 50

  Fly   295 VAPAPVAVPVSVPVAKPQPVPVAVPVTTAL-----ITDLDDEEVVFKPTVQEAPKAPTIAAP--- 351
                 :.:|.| |:.|.:         |.|     :|..|...||.|....:..:...:|:|   
plant    51 -----LLLPPS-PLRKSR---------TRLSDRLEMTSEDAMAVVRKRGKGKGGQKSLLASPRNP 100

  Fly   352 ---------------------VVEPKPEPPKPKVEPAKPKVVPVAPVESTQPQPKIASVEEIFCK 395
                                 :|:..|...|....|.|.|.....|:.|:...|..       |:
plant   101 RRSRRRSEAVEEKEANLVIEEIVKLPPRKRKTNGRPKKDKQSSAPPLCSSSDLPNT-------CQ 158

  Fly   396 YGLDAWFKPERLHPQVESLIYWRDVKKSGIVFGAGLITLAAISS-------FSVISVFAYLSLLT 453
            ..|:.      :...:..|:.||||.||.:.||.|  .|:.:||       |||.|..:.|.|:.
plant   159 SDLNL------IGEIISDLVMWRDVAKSTLWFGFG--CLSFLSSCFAKGVNFSVFSAVSNLGLVL 215

  Fly   454 LFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLV 518
            |.|:     :.|.| ..|:.||.      .:....:|.:.|...|...:...|.|||:...||..
plant   216 LCGS-----FLSNT-LCQRKNED------TKRAFHVSEDDVLRSARRVLPATNFFISKTSELFSG 268

  Fly   519 ED---------IIDSIKFG--VILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHL 572
            |.         ::...::|  :.||..:..|            |...||:||:|......|...:
plant   269 EPSMTLKVTPFLLLGAEYGHLITLWRLSAFG------------FFLSFTIPKLYSCYTHQISQKV 321

  Fly   573 DLVRSKLTE 581
            :.|::::.|
plant   322 ERVKTRIGE 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 47/181 (26%)
AT2G20590NP_179649.2 Reticulon 169..324 CDD:280592 47/180 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.