DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and rtn2a

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_005157528.1 Gene:rtn2a / 569502 ZFINID:ZDB-GENE-060420-1 Length:451 Species:Danio rerio


Alignment Length:434 Identity:109/434 - (25%)
Similarity:185/434 - (42%) Gaps:102/434 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 TAPSTANFYDDEEDDFLGKPTTAAPAA---PVAPLTKANQDSDTESPSVSYTPSPAKKPIVDALK 254
            |.|.:........|....:|...:||.   |.|.|| .:.:.|.|..|..:|   .:...::.|:
Zfish    99 TGPRSGRGSLHRTDTLETQPPPDSPAVEWDPHAFLT-LDGEGDVEEESQMWT---VETQSLETLQ 159

  Fly   255 DQDN------EKF--ISSEDLASDFKEEPRSAPTPAPAPAPILDAAPAVAPAPVAVPVSVPVAKP 311
            |:|.      ||.  |.|.:|....:||..:.|   ..||    :.||||..             
Zfish   160 DKDTGTWDTAEKISGIQSYNLTCSHQEEQITVP---QLPA----SDPAVATE------------- 204

  Fly   312 QPVPVAVPVTTALITDLDDEEVVFKPTVQEAPKAPTIAAPVVEPKPEPPKPKVEPAKPKVVPVAP 376
                     |||              |:|.|..:.|:          ||.            |.|
Zfish   205 ---------TTA--------------TLQTAEASHTM----------PPS------------VGP 224

  Fly   377 VESTQPQPKIASVEEIFCKYGLDAWF------KPERLHPQ--VESLIYWRDVKKSGIVFGAGLIT 433
              :||        ||..||    .||      :...:|.|  |..|:||:|::::|:|....::.
Zfish   225 --NTQ--------EEQTCK----QWFSSLSLSEGPTIHIQIAVMDLVYWKDMERTGMVLTGLVVA 275

  Fly   434 LAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGHPFKDYLELDLTLSHEKVQNIA 498
            |.::...|:|:|.:.|||..|..|::.|||..:...:|..:..|||:.||:||::||.|:.::..
Zfish   276 LLSLFQLSIITVVSTLSLAILCFTISVRIYYKLLHVLQLGDGVHPFQSYLDLDISLSGEEAEHCL 340

  Fly   499 GVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYEN 563
            ..|:......:..||.|..|.::..|:||.::::|.|::|...||:||:|:..:::|::|..|..
Zfish   341 QRAIVLSCSALETLRNLIFVGNLFSSLKFWLLMYVVTFLGNLCNGLTLIIIGVIAVFSVPLFYTR 405

  Fly   564 NKQSIDTHLDLVRSKLTEITDKIRVAIPIGNKKPEAAAESEKDK 607
            ::..:|:.:..|::::..|.|........|...|:......|.|
Zfish   406 HQDKVDSCIVAVQAQIDNIKDFFYRLTQGGGPPPDPTPGGAKPK 449

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 50/163 (31%)
rtn2aXP_005157528.1 Reticulon 253..414 CDD:280592 50/160 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592796
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
54.700

Return to query results.
Submit another query.