DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and rtn3

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_031755957.1 Gene:rtn3 / 549516 XenbaseID:XB-GENE-975126 Length:580 Species:Xenopus tropicalis


Alignment Length:249 Identity:102/249 - (40%)
Similarity:154/249 - (61%) Gaps:21/249 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   358 EPPKPKVEPAKPKVV-PVA--------PVESTQPQPKIASVEEIFCKYGLDAWFKPERLHP-QVE 412
            |.|:.:...:.|::: |:|        .:|..|...|:..|.:           .|..:.. :|:
 Frog   340 EDPESESRESSPEILYPIAQSGSAEALKMEVLQTYHKLPQVTD-----------SPVDIATLKVQ 393

  Fly   413 SLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFGTVAFRIYKSVTQAVQKTNEGH 477
            .|:||||||:||:|||..::.|.::::||:|||.:||.|..|..|:::|:||||.||||||:|||
 Frog   394 DLLYWRDVKQSGMVFGGTMVLLLSLAAFSIISVISYLVLSLLAVTISYRVYKSVLQAVQKTDEGH 458

  Fly   478 PFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWVFTYVGAWFN 542
            |||..||.|:.||.:..|.....::||:|..:..:.|||||||::||:|..:::|:.|||||.||
 Frog   459 PFKPLLEKDIALSSDAFQKALSTSLAHVNHALKYIVRLFLVEDLVDSLKLALLMWLMTYVGAVFN 523

  Fly   543 GMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTEITDKIRVAIPIGNKK 596
            |:||:||..:..||.|.|||..|..||.::.||.|.:..||:||:..:|...||
 Frog   524 GITLLILGVLLAFTAPIVYEKYKVQIDHYVSLVHSHVKSITEKIQAKLPGALKK 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 82/163 (50%)
rtn3XP_031755957.1 Reticulon 392..556 CDD:396837 82/163 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 195 1.000 Domainoid score I3083
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 1 1.000 - - otm47794
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2275
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.940

Return to query results.
Submit another query.