DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and Prr18

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_006227993.1 Gene:Prr18 / 361481 RGDID:1564079 Length:413 Species:Rattus norvegicus


Alignment Length:349 Identity:73/349 - (20%)
Similarity:97/349 - (27%) Gaps:155/349 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 AGKEVKQGISGLTTDFMNAERGFSAPLAPFSETVAQAPVIPAQAPAVPDHAPAV----------P 156
            ||:.:...:.|....|        :|:.|        |..|...||.....||.          |
  Rat   101 AGRTLMLRLLGRVMSF--------SPMPP--------PPPPPPPPARTQGGPAARQLSRRPCGPP 149

  Fly   157 APVAPAPAVPAP-----LPVEEDL-------------------LGSFTDQPSAPLQAFQPTAPST 197
            |...||||..|.     .|.|..|                   ||..|.||  |..|..|..||.
  Rat   150 AASPPAPAAAAAGEKKRRPPEMLLSSSWPSATLKRPPARRGPGLGPGTPQP--PTSARVPPQPSP 212

  Fly   198 ANFYDDEEDDFLGKPTTAA-------------PAAPVAPLTKANQDSDTESP---SVSYTPSPAK 246
                        |:..|:|             ||...|..|.|...:..|..   |:|.||    
  Rat   213 ------------GRGGTSATCSAPRRIACSHIPAGSTASGTSAGAGAGPEDATRFSLSLTP---- 261

  Fly   247 KPIVDALKDQDNEKFISSEDLASDFKEEPRSAPTPAPAPAPILDAAPAVAPAP--------VAVP 303
                :|:      ..|....|.......||     .|.|||..|....:.|.|        ...|
  Rat   262 ----EAI------LVIQRRHLEKQLLARPR-----RPFPAPSADPRRPLVPCPRTRSSTLRRGGP 311

  Fly   304 VSVPVAKPQPVPVAVPVTTALITDLDDEEVVFKPTVQEAPKAPTIAAPVVEPKPEPPKPKVEPAK 368
            .|||.|     |:||.|::                                   .||:..:.|  
  Rat   312 TSVPDA-----PLAVAVSS-----------------------------------RPPRASLLP-- 334

  Fly   369 PKVVPVAPVESTQPQPKIASVEEI 392
                  ..:::|.|.|:.:|:..:
  Rat   335 ------GGLQATMPSPRPSSLRPV 352

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592
Prr18XP_006227993.1 PRR18 162..413 CDD:292299 54/272 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351053
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.