DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and rtn1

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001018789.2 Gene:rtn1 / 3361269 PomBaseID:SPBC31A8.01c Length:308 Species:Schizosaccharomyces pombe


Alignment Length:272 Identity:52/272 - (19%)
Similarity:99/272 - (36%) Gaps:44/272 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   337 PTVQEAPKA-PTIAAPVVE----PKPEPPKPKVEPAKPKVVPVAPVESTQ-PQPKIASVEEIFCK 395
            |:....|.| |....||::    ...||.............||.||.... ...|.....|..|.
pombe    46 PSATSFPSALPNSENPVIQNISSSSSEPHHTSQSTPGETSSPVCPVSGAHGGADKKCPALEAGCP 110

  Fly   396 YGLDAWFKPERLHPQVE----SLIYWRDVKKSGIVFGAGLITLAAISSFSVISVFAYLSLLTLFG 456
            :....   .:.:.|::.    |::.|::...|       ..||.:|  .:::.|.::::|..|| 
pombe   111 FTNTT---KQNVDPEISNALWSVLTWKNTSCS-------FSTLMSI--LALVYVPSWINLPRLF- 162

  Fly   457 TVAFRIYKSVTQAVQKTNEGHPF---------KDYLELDLTLSHEKVQNIAGVAVAHINGFISEL 512
               ||.::.|.........|..|         ..:....:|...:.:..|....|...|..:.:.
pombe   163 ---FRTFRYVFLITSIIEFGGLFASNGKRGVLSHFRSSYITCDSKALDRIVNSIVDIFNVMLIQF 224

  Fly   513 RRLFLVEDIIDSIKFGVILWVFTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHL----- 572
            :|:...|..|.:....|..::..::..:.:..:|.:...:..|.||::|..|::|| .||     
pombe   225 QRILFAESPILTFTASVAAFIEFFLSGFLSYKSLFVWNVLFAFILPRLYVCNERSI-KHLVASLE 288

  Fly   573 ---DLVRSKLTE 581
               |.::.:.||
pombe   289 RSGDKLKKQATE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 34/184 (18%)
rtn1NP_001018789.2 Reticulon 130..285 CDD:280592 32/168 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1792
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.