DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and PRR18

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_787118.2 Gene:PRR18 / 285800 HGNCID:28574 Length:295 Species:Homo sapiens


Alignment Length:267 Identity:54/267 - (20%)
Similarity:68/267 - (25%) Gaps:88/267 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   153 PAVPAPVAPAPAVPA-----------------PLPVEEDLLGSF------------------TDQ 182
            |.:|.|.||||...|                 |....|.||.|.                  ..|
Human     4 PPMPPPPAPAPGAQAARQLPRRPCAAGDKKKRPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQ 68

  Fly   183 PSAPLQAFQPTAPSTANFYDDEEDDFLGKPTTAAPAAPVA----------PLTKANQDSDTESPS 237
            |.||........||.|.           .|.|.||..|..          ..|.|...:.....|
Human    69 PPAPPGVSPQALPSRAR-----------APATCAPPRPAGSGHSPARTTYAATSAGTGTTAAGTS 122

  Fly   238 VSYTPSPAKKPIVDALKDQDNEKFISSEDLASDFKEEPRSAPTPAPAPAPILDAAPAVAPAPVAV 302
            ....|.|............:....|....|.......|| .|.|:|:..|....||.: ||..|.
Human   123 SGAGPCPDSAARFCLNLTPEAVLVIQKRHLEKQLLARPR-RPFPSPSAEPRRLLAPCL-PARAAG 185

  Fly   303 PVSVPVAKPQPVPVAVPVTTALITDLDDEEVVFKPTVQEAPKAPT---------IAAPVVEPKPE 358
            |.....|.....|                     ||..:..:||.         :..|.:.|:|.
Human   186 PRRGGPASDPDAP---------------------PTAGQGRRAPPPGAQLLHGGLQVPQLSPRPG 229

  Fly   359 PPKPKVE 365
            ..:|.::
Human   230 ALRPMLK 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592
PRR18NP_787118.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..133 30/139 (22%)
PRR18 28..295 CDD:292299 46/243 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 181..227 10/66 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157093
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.