Sequence 1: | NP_001162875.1 | Gene: | Rtnl1 / 33721 | FlyBaseID: | FBgn0053113 | Length: | 607 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_787118.2 | Gene: | PRR18 / 285800 | HGNCID: | 28574 | Length: | 295 | Species: | Homo sapiens |
Alignment Length: | 267 | Identity: | 54/267 - (20%) |
---|---|---|---|
Similarity: | 68/267 - (25%) | Gaps: | 88/267 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 153 PAVPAPVAPAPAVPA-----------------PLPVEEDLLGSF------------------TDQ 182
Fly 183 PSAPLQAFQPTAPSTANFYDDEEDDFLGKPTTAAPAAPVA----------PLTKANQDSDTESPS 237
Fly 238 VSYTPSPAKKPIVDALKDQDNEKFISSEDLASDFKEEPRSAPTPAPAPAPILDAAPAVAPAPVAV 302
Fly 303 PVSVPVAKPQPVPVAVPVTTALITDLDDEEVVFKPTVQEAPKAPT---------IAAPVVEPKPE 358
Fly 359 PPKPKVE 365 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rtnl1 | NP_001162875.1 | Reticulon | 411..575 | CDD:280592 | |
PRR18 | NP_787118.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..133 | 30/139 (22%) | |
PRR18 | 28..295 | CDD:292299 | 46/243 (19%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 181..227 | 10/66 (15%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165157093 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |