DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and prr18

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:XP_005156569.1 Gene:prr18 / 101885898 ZFINID:ZDB-GENE-081107-6 Length:253 Species:Danio rerio


Alignment Length:86 Identity:20/86 - (23%)
Similarity:34/86 - (39%) Gaps:18/86 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RNFDE--LKKEAAATNEDIFKQAQRAYEDSALGGDTGNVSG-------GAQDDNAHTEHYFANEQ 58
            ||.::  :.|:....:.|:  :.:|.:......|.:.|.|.       |:.|.:|..:....|:|
Zfish   141 RNLEKQMMAKQKCCASADL--RHRRVFPSKRAQGGSNNKSSCPVAKLDGSNDISAIVKISLLNDQ 203

  Fly    59 KKLD-------FGDAQEFVQR 72
            .|.|       .||..|.|.|
Zfish   204 HKYDDVEYEEEDGDVDETVMR 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592
prr18XP_005156569.1 PRR18 41..251 CDD:292299 20/86 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170592788
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.