DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rtnl1 and CG42853

DIOPT Version :9

Sequence 1:NP_001162875.1 Gene:Rtnl1 / 33721 FlyBaseID:FBgn0053113 Length:607 Species:Drosophila melanogaster
Sequence 2:NP_001189128.1 Gene:CG42853 / 10178880 FlyBaseID:FBgn0262100 Length:284 Species:Drosophila melanogaster


Alignment Length:206 Identity:49/206 - (23%)
Similarity:90/206 - (43%) Gaps:39/206 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   411 VESLIYWRDVKKSGIVFGAGLITLAAI-------SSFSVISVFAYLSLLTLFGTVAFRIYKSVTQ 468
            :..||.||:..||.:||    :.|..|       ....|:||:|.:.::...|      |:.:.|
  Fly    29 ITELILWRNWIKSMLVF----VMLQTIIYDLLSEPLVFVVSVWALIIMVISMG------YRFLVQ 83

  Fly   469 AVQKTNEGHPFKDYLELDLTLSHEKVQNIAGVAVAHINGFISELRRLFLVEDIIDSIKFGVILWV 533
            ......:.:.:..||::||.:|.|..:.:..:....:..|::.||.:.||:....|.|:..:|.:
  Fly    84 YTNTHIQNNSYPKYLDIDLRISQELSKQLGVLVSTKVVAFLNNLREILLVKSFSKSFKWFGLLLI 148

  Fly   534 FTYVGAWFNGMTLVILAFVSLFTLPKVYENNKQSIDTHLDLVRSKLTEITDKIRVAIPIGNK--- 595
            .:.:|...|.:.:..|....|||:||:.|.|::|.:.                 |.:|..||   
  Fly   149 ISKLGKQINFLIVGQLGLFLLFTIPKMCEMNRRSSNI-----------------VQLPKFNKQYQ 196

  Fly   596 --KPEAAAESE 604
              |..|:.|::
  Fly   197 ITKVNASTETQ 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rtnl1NP_001162875.1 Reticulon 411..575 CDD:280592 42/170 (25%)
CG42853NP_001189128.1 Reticulon 31..179 CDD:280592 40/157 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 65 1.000 Domainoid score I3611
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000492
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.