DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8892 and AT3G23605

DIOPT Version :9

Sequence 1:NP_001260064.1 Gene:CG8892 / 33719 FlyBaseID:FBgn0031664 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_566733.1 Gene:AT3G23605 / 821940 AraportID:AT3G23605 Length:152 Species:Arabidopsis thaliana


Alignment Length:107 Identity:24/107 - (22%)
Similarity:34/107 - (31%) Gaps:31/107 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   375 PDGASDNESLEEFDDEELKGVAAASFENHLGEAKTELTALKL-----------RLLNAAGTDEMV 428
            |...|:.|| ||.::......|...|.|...|...::....|           |:..:....|.|
plant    31 PKRFSEEES-EETENTTNSSNAVFGFPNLPEEPNRDMDQSVLCRICVRLPDGRRIQRSFLKSESV 94

  Fly   429 QLRWPSDTKLQTLRLYISQTHKHIPQDG------YKLICAFP 464
            ||.|             |..:..|..:.      :|||..||
plant    95 QLLW-------------SFCYSQIGDESSERKRRFKLIQGFP 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8892NP_001260064.1 UBA_4 9..46 CDD:291236
UAS 183..294 CDD:239256
UBQ 412..488 CDD:294102 14/70 (20%)
AT3G23605NP_566733.1 UBQ 72..>123 CDD:294102 11/63 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1364
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1130151at2759
OrthoFinder 1 1.000 - - FOG0002610
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.