DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8892 and AT4G14245

DIOPT Version :10

Sequence 1:NP_608891.1 Gene:CG8892 / 33719 FlyBaseID:FBgn0031664 Length:496 Species:Drosophila melanogaster
Sequence 2:NP_001328230.1 Gene:AT4G14245 / 28720127 AraportID:AT4G14245 Length:344 Species:Arabidopsis thaliana


Alignment Length:110 Identity:26/110 - (23%)
Similarity:33/110 - (30%) Gaps:36/110 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PSTSSSSSGSAKSAVSECLGAW------LNYLQIMNNLC----------AAGYRLAQTIAALEPW 61
            |||:......|...|  ||..|      .:.......||          ..|.::..|      |
plant  1055 PSTTCQEDSCANQGV--CLQQWDGFSCDCSMTSFRGPLCNDPGITYIFSKGGGQITYT------W 1111

  Fly    62 AYFEHPSTATAAAFITAWDELARASVMATSTVKSHIVSVLQDFKT 106
            ...:.|||..        |.||    :..|||:...|.|..|..|
plant  1112 PPNDRPSTRA--------DRLA----VGFSTVQKEAVLVRVDSST 1144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8892NP_608891.1 UBA_4 8..50 CDD:464207 11/52 (21%)
UAS 183..294 CDD:239256
UBX 414..491 CDD:340466
AT4G14245NP_001328230.1 UAS 26..144 CDD:214737
UBX 268..342 CDD:340466
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.