DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3792 and MPDU1

DIOPT Version :9

Sequence 1:NP_608889.1 Gene:CG3792 / 33717 FlyBaseID:FBgn0031662 Length:252 Species:Drosophila melanogaster
Sequence 2:XP_006721660.1 Gene:MPDU1 / 9526 HGNCID:7207 Length:260 Species:Homo sapiens


Alignment Length:117 Identity:59/117 - (50%)
Similarity:86/117 - (73%) Gaps:2/117 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LMSEKCYDNYFLYHNFLDVPCFKALLSKGLGLAIIAGSVLVKVPQVLKILNSKSGEGINIVGVVL 76
            |:.|||||..|:..:.|.|||.|.||||||||.|:|||:|||:|||.|||.:||.||:::..|:|
Human    17 LLPEKCYDQLFVQWDLLHVPCLKILLSKGLGLGIVAGSLLVKLPQVFKILGAKSAEGLSLQSVML 81

  Fly    77 DLLAISFHLSYNFMHGYPFSAWGDSTFLAIQTVTIAVLVLFFNGR--KAQSG 126
            :|:|::..:.|:..:.:|||:||::.||.:||:||..||:.:.|:  ||..|
Human    82 ELVALTGTMVYSITNNFPFSSWGEALFLMLQTITICFLVMHYRGQTVKASPG 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3792NP_608889.1 2A43 36..230 CDD:130026 47/93 (51%)
PQ-loop 38..96 CDD:282099 29/57 (51%)
CTNS 162..193 CDD:128923
MPDU1XP_006721660.1 PQ-loop 43..101 CDD:282099 29/57 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157812
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3581
Inparanoid 1 1.050 232 1.000 Inparanoid score I3432
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54113
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004326
OrthoInspector 1 1.000 - - oto89219
orthoMCL 1 0.900 - - OOG6_102406
Panther 1 1.100 - - LDO PTHR12226
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2651
SonicParanoid 1 1.000 - - X3055
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1413.790

Return to query results.
Submit another query.