DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3792 and AT4G07390

DIOPT Version :9

Sequence 1:NP_608889.1 Gene:CG3792 / 33717 FlyBaseID:FBgn0031662 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001328799.1 Gene:AT4G07390 / 826170 AraportID:AT4G07390 Length:235 Species:Arabidopsis thaliana


Alignment Length:222 Identity:74/222 - (33%)
Similarity:115/222 - (51%) Gaps:16/222 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NFLDVPCFKALLSKGLGLAIIAGSVLVKVPQVLKILNSKSGEGINIVGVVLDLLAISFHLSYNFM 90
            :|.:..|...|:||.||..::|.|:.||:||::||:..||..|:::|...|:::..:..|:|...
plant    19 DFPEKDCLLPLISKLLGYCLVAASITVKLPQIMKIVQHKSVRGLSVVAFELEVVGYTISLAYCLH 83

  Fly    91 HGYPFSAWGDSTFLAIQTVTIAVLVLFFNGRKAQSGLFLVGYVVLMY------VLNSGLTP--MS 147
            .|.||||:|:..||.||.:.:...:.::    :|..........|:|      ||...:.|  ..
plant    84 KGLPFSAFGEMAFLLIQALILVACIYYY----SQPVPVTTWIRPLLYCAVAPTVLAGQINPTLFE 144

  Fly   148 VLFTIQSCNIPILLVGKLSQAYTNYQAGSTGQLSAATVIMMFAGSVARIFTSIQETGDFMIILTF 212
            .|:..|..   |.|..:|.|.:.|::..|||:||..|..|.||||:.|:|||:||.....|:..|
plant   145 ALYASQHA---IFLFARLPQIWKNFKNKSTGELSFLTFFMNFAGSIVRVFTSLQEKAPISILTGF 206

  Fly   213 IASTFANSVILGQLIYYWNKPAGVKVK 239
            ......|..||.|::.| :|||..|.|
plant   207 ALGVVTNGSILTQILLY-SKPAAAKEK 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3792NP_608889.1 2A43 36..230 CDD:130026 66/201 (33%)
PQ-loop 38..96 CDD:282099 21/57 (37%)
CTNS 162..193 CDD:128923 13/30 (43%)
AT4G07390NP_001328799.1 2A43 29..223 CDD:130026 66/200 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3581
Inparanoid 1 1.050 119 1.000 Inparanoid score I1991
OMA 1 1.010 - - QHG54113
OrthoDB 1 1.010 - - D1059579at2759
OrthoFinder 1 1.000 - - FOG0004326
OrthoInspector 1 1.000 - - otm3221
orthoMCL 1 0.900 - - OOG6_102406
Panther 1 1.100 - - LDO PTHR12226
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3055
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.