DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3792 and slc66a3

DIOPT Version :9

Sequence 1:NP_608889.1 Gene:CG3792 / 33717 FlyBaseID:FBgn0031662 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001015930.2 Gene:slc66a3 / 548684 XenbaseID:XB-GENE-5946334 Length:204 Species:Xenopus tropicalis


Alignment Length:187 Identity:48/187 - (25%)
Similarity:86/187 - (45%) Gaps:11/187 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 VLVKVPQVLKILNSKSGEGINIVGVVLDLLAISFHLSYNFMHGYPFSAWGDSTFLAIQTVTIAVL 114
            :::|.||:|.::.|||.||:::..|:|:|....|.|.|...:.||...:.:...|..|...:.:.
 Frog    20 MVLKFPQILSVMASKSAEGVSLQSVLLELAGFLFFLRYQMYYNYPMETYLEYPILIAQDAVLLLF 84

  Fly   115 VLFFNGRKAQ----SGLFLVGYVVLMYVLNSGLTPMSVLFTIQSCNIPILLVGKLSQAYTNYQAG 175
            :..:.|....    :|:|...:.:|  .|:..:..:::..    |. .|....|:.|....:...
 Frog    85 LFHYTGSVKNALPYAGIFFAAWNIL--ALHKWIIDLALYL----CT-GISAASKIVQIQYLWLTK 142

  Fly   176 STGQLSAATVIMMFAGSVARIFTSIQETGDFMIILTFIASTFANSVILGQLIYYWNK 232
            .:||.||.|.|:....|..||||::..|||..::|.||.....|..:...::.|..|
 Frog   143 DSGQASALTWILAMYTSATRIFTTLATTGDSAVLLRFIVLLILNGCVTAMILMYRKK 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3792NP_608889.1 2A43 36..230 CDD:130026 46/183 (25%)
PQ-loop 38..96 CDD:282099 17/45 (38%)
CTNS 162..193 CDD:128923 8/30 (27%)
slc66a3NP_001015930.2 2A43 13..197 CDD:130026 46/183 (25%)
PQ-loop 13..>55 CDD:367864 13/34 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1059579at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.