DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3792 and mpdu1a

DIOPT Version :9

Sequence 1:NP_608889.1 Gene:CG3792 / 33717 FlyBaseID:FBgn0031662 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_001004545.1 Gene:mpdu1a / 447806 ZFINID:ZDB-GENE-040912-9 Length:258 Species:Danio rerio


Alignment Length:245 Identity:94/245 - (38%)
Similarity:149/245 - (60%) Gaps:12/245 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLMSEKCYDNYFLYHNFLDVPCFKALLSKGLGLAIIAGSVLVKVPQVLKILNSKSGEGINIVGVV 75
            |.|.|||||.:|.|.||:.|||.|.:|||.:|:.|:.|.|:..:||:.|||...|..|:.:..|.
Zfish    20 FFMPEKCYDQFFFYFNFMHVPCLKIVLSKTMGIFILMGIVIAPLPQICKILWCGSSYGLCLTSVF 84

  Fly    76 LDLLAISFHLSYNFMHGYPFSAWGDSTFLAIQTVTIAVLVLFFNGRKAQSGLFLVG-YVVLMYVL 139
            |||:|||.|.::.:...:|..|||:|.|..||...:|:|:....| |...|:||:. :..:|::|
Zfish    85 LDLMAISTHAAFCYTQNFPIGAWGESLFAVIQIALLALLIHHHEG-KTIKGIFLLALFCGVMFLL 148

  Fly   140 NSGLTPMSVLFTIQSCNIPILLVGKLSQAYTNYQAGSTGQLSAATVIMMFAGSVARIFTSIQETG 204
            .|.|||::|::|:...|:..::..:..|..:|::.|.|||||..:|.::|.||:.|:|:|:|:||
Zfish   149 ASPLTPVAVVWTLYEWNVLFVVASRFFQVVSNFRCGHTGQLSILSVFLVFLGSLGRVFSSLQDTG 213

  Fly   205 DFMIILTFIA--STFA---NSVILGQLIYYWNKPAGVKVKDSKAKKPKTK 249
                 .:|.|  .|.|   :.:||.|::.||||......|:::.||.|.:
Zfish   214 -----FSFSAQMQTLACCCSWLILAQILMYWNKCTTNSKKEAQMKKDKAE 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3792NP_608889.1 2A43 36..230 CDD:130026 71/199 (36%)
PQ-loop 38..96 CDD:282099 22/57 (39%)
CTNS 162..193 CDD:128923 11/30 (37%)
mpdu1aNP_001004545.1 2A43 44..239 CDD:130026 71/200 (36%)
PQ-loop 47..104 CDD:282099 21/56 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593602
Domainoid 1 1.000 45 1.000 Domainoid score I12202
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54113
OrthoDB 1 1.010 - - D1059579at2759
OrthoFinder 1 1.000 - - FOG0004326
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12226
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X3055
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.