DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3792 and Pqlc3

DIOPT Version :9

Sequence 1:NP_608889.1 Gene:CG3792 / 33717 FlyBaseID:FBgn0031662 Length:252 Species:Drosophila melanogaster
Sequence 2:NP_766162.2 Gene:Pqlc3 / 217430 MGIID:2444067 Length:202 Species:Mus musculus


Alignment Length:178 Identity:40/178 - (22%)
Similarity:81/178 - (45%) Gaps:3/178 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 VKVPQVLKILNSKSGEGINIVGVVLDLLAISFHLSYNFMHGYPFSAWGDSTFLAIQTVTIAVLVL 116
            :|:||:...|.::|..||::..::|:|......|.|...:|.|...:.:...|..|.:.:.:.|.
Mouse    20 LKLPQIYAQLAARSARGISLPSLLLELAGFLVFLRYQHYYGNPLLTYLEYPILIAQDIVLLLFVF 84

  Fly   117 FFNGRKAQSGLFLVGYVVLMYVLNSGLTPMSVLFTIQSCNIPILLVGKLSQAYTNYQAGSTGQLS 181
            .|||...|:..::..:|...::|:  |....:...:..|.: |....|.:|....::...:|.:|
Mouse    85 HFNGNVKQALPYMAVFVSSWFILS--LQKWIIDLAMNLCTV-ISAASKFAQLQYLWKVQDSGAVS 146

  Fly   182 AATVIMMFAGSVARIFTSIQETGDFMIILTFIASTFANSVILGQLIYY 229
            |.|..:.......||.|::..|.|..|::.|:.....|..:...:::|
Mouse   147 ALTWGLSAYTCATRIITTLMTTNDLTILIRFVIMLALNIWVTATVLHY 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3792NP_608889.1 2A43 36..230 CDD:130026 40/178 (22%)
PQ-loop 38..96 CDD:282099 13/43 (30%)
CTNS 162..193 CDD:128923 6/30 (20%)
Pqlc3NP_766162.2 PQ-loop 5..>53 CDD:367864 9/32 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3211
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1059579at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.