DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3756 and POLR1C

DIOPT Version :9

Sequence 1:NP_608885.1 Gene:CG3756 / 33712 FlyBaseID:FBgn0031657 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_976035.1 Gene:POLR1C / 9533 HGNCID:20194 Length:346 Species:Homo sapiens


Alignment Length:314 Identity:170/314 - (54%)
Similarity:226/314 - (71%) Gaps:4/314 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 PQDYGLADDVFSVQAFKEKLHIKIVRNDEDGLEFDLIGVYPAIANAFRRLMLSDVPSMAIEKVYI 86
            |.:|...||.:....|::...:.:|..||:.||||::|:..||||||||::|::||:||:|||.:
Human    30 PGNYSGYDDAWDQDRFEKNFRVDVVHMDENSLEFDMVGIDAAIANAFRRILLAEVPTMAVEKVLV 94

  Fly    87 YNNTSIIQDEVLAHRMGLLPLRADPRLFAYRTEESTEAGTEQDTLEFELKVKCSRRRDAGKDQSN 151
            ||||||:|||:||||:||:|:.||||||.|| .:..|.|||.|||:|.|:|:|:|...|.||.|:
Human    95 YNNTSIVQDEILAHRLGLIPIHADPRLFEYR-NQGDEEGTEIDTLQFRLQVRCTRNPHAAKDSSD 158

  Fly   152 FDDIYKNHKVYSGHLKWLPKGKQAQIYSESAVNCIHDDILIAQLRPGHELDLRLVAVKGLGRDHA 216
            .:::|.|||||:.|:.|:|.|.||.::.|..:..:||||||||||||.|:||.:..|||:|:|||
Human   159 PNELYVNHKVYTRHMTWIPLGNQADLFPEGTIRPVHDDILIAQLRPGQEIDLLMHCVKGIGKDHA 223

  Fly   217 KFSPVATATYRLLPMIKLNREVTGKDAYLLQNCFSPGVIGIDE---NETAYVKDARYDTCSRNVY 278
            ||||||||:|||||.|.|...|.|:.|..|..|||||||.:.|   .:.|.|.:.|.||.||.::
Human   224 KFSPVATASYRLLPDITLLEPVEGEAAEELSRCFSPGVIEVQEVQGKKVARVANPRLDTFSREIF 288

  Fly   279 RYPQLNDAVTLARIRDHYIFSVESVGALKPDVIFLEAVKVLKRKCRALIDEIEA 332
            |..:|...|.|||:||||||||||.|.|.|||:..||:|||..|||..:||::|
Human   289 RNEKLKKVVRLARVRDHYIFSVESTGVLPPDVLVSEAIKVLMGKCRRFLDELDA 342

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3756NP_608885.1 RNAP_I_II_AC40 41..329 CDD:132910 162/290 (56%)
RPOLD 53..327 CDD:214766 159/276 (58%)
POLR1CNP_976035.1 RNAP_I_II_AC40 49..339 CDD:132910 162/290 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159244
Domainoid 1 1.000 321 1.000 Domainoid score I1234
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3586
Inparanoid 1 1.050 349 1.000 Inparanoid score I2289
Isobase 1 0.950 - 0 Normalized mean entropy S590
OMA 1 1.010 - - QHG54254
OrthoDB 1 1.010 - - D359369at33208
OrthoFinder 1 1.000 - - FOG0003669
OrthoInspector 1 1.000 - - oto90735
orthoMCL 1 0.900 - - OOG6_102180
Panther 1 1.100 - - LDO PTHR11800
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1180
SonicParanoid 1 1.000 - - X2540
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1514.890

Return to query results.
Submit another query.