DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3756 and POLR2C

DIOPT Version :9

Sequence 1:NP_608885.1 Gene:CG3756 / 33712 FlyBaseID:FBgn0031657 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_116558.1 Gene:POLR2C / 5432 HGNCID:9189 Length:275 Species:Homo sapiens


Alignment Length:298 Identity:85/298 - (28%)
Similarity:146/298 - (48%) Gaps:47/298 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IKIVRNDEDGLEFDLIGVYPAIANAFRRLMLSDVPSMAIEKVYIYNNTSIIQDEVLAHRMGLLPL 107
            ::|....::.::|.:.....|:||:.||:.:::||.:||:.|.|..|:|::.||.:|||:||:||
Human     9 VRITELTDENVKFIIENTDLAVANSIRRVFIAEVPIIAIDWVQIDANSSVLHDEFIAHRLGLIPL 73

  Fly   108 RADPRL--FAYRTEESTEAGTEQDTLEFELKVKCSRRRDAGKDQSNFDDIYKNHKVYSGHLKWLP 170
            .:|..:  ..|..:.:.|....:.::||.|.|:|:  .|..:..::.|.|..:.:|       :|
Human    74 ISDDIVDKLQYSRDCTCEEFCPECSVEFTLDVRCN--EDQTRHVTSRDLISNSPRV-------IP 129

  Fly   171 -----KGKQAQIYSESAVNCIHDDILIAQLRPGHELDLRLVAVKGLGRDHAKFSPVATATYRLLP 230
                 :......|.|      .|||||.:||.|.||.||..|.||.|::|||::|.|...:...|
Human   130 VTSRNRDNDPNDYVE------QDDILIVKLRKGQELRLRAYAKKGFGKEHAKWNPTAGVAFEYDP 188

  Fly   231 MIKLNREVTGKDAYLLQNCFSPGVIGIDENETAYVKDARYDTCSRNVYRYPQLNDAVTLARIRDH 295
            ...|...|..|.....::.:|.    :||:|:    .|.||...:                 .:.
Human   189 DNALRHTVYPKPEEWPKSEYSE----LDEDES----QAPYDPNGK-----------------PER 228

  Fly   296 YIFSVESVGALKPDVIFLEAVKVLKRKCRALIDEIEAE 333
            :.::|||.|:|:|:.|.|.|:..||:|...|..::..|
Human   229 FYYNVESCGSLRPETIVLSALSGLKKKLSDLQTQLSHE 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3756NP_608885.1 RNAP_I_II_AC40 41..329 CDD:132910 84/292 (29%)
RPOLD 53..327 CDD:214766 82/280 (29%)
POLR2CNP_116558.1 RNAP_II_RPB3 7..266 CDD:132909 84/296 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..226 7/47 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0202
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D834009at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.