DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr1C and POLR2C

DIOPT Version :10

Sequence 1:NP_608885.1 Gene:Polr1C / 33712 FlyBaseID:FBgn0031657 Length:333 Species:Drosophila melanogaster
Sequence 2:NP_116558.1 Gene:POLR2C / 5432 HGNCID:9189 Length:275 Species:Homo sapiens


Alignment Length:47 Identity:13/47 - (27%)
Similarity:20/47 - (42%) Gaps:8/47 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 GNGGSTTGSTAGGGGAAG------GGP--LSDAPKRISIREFLLVKE 58
            |...:..|.|..|....|      |||  |:|..|..::.:..||::
Human    52 GFDSTKEGVTEAGAPQGGQRTHTKGGPVILADEIKNPAMEKLELVRK 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr1CNP_608885.1 RNAP_I_II_AC40 41..329 CDD:132910 5/18 (28%)
POLR2CNP_116558.1 RNAP_II_RPB3 7..266 CDD:132909 13/47 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 203..226
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.