DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scox and SCO2

DIOPT Version :9

Sequence 1:NP_608884.1 Gene:Scox / 33711 FlyBaseID:FBgn0262467 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001162580.1 Gene:SCO2 / 9997 HGNCID:10604 Length:266 Species:Homo sapiens


Alignment Length:240 Identity:112/240 - (46%)
Similarity:158/240 - (65%) Gaps:17/240 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 RRW---AQQPAIRHYAAPADSTKG----KGPISWRSLAVIGALGAGGVGFMLYVKSEKDEARMKE 70
            |.|   .|.||         .|.|    :||.....|.:.|..|||..|..|.:::||:..:.::
Human    34 RSWLLSRQGPA---------ETGGQGQPQGPGLRTRLLITGLFGAGLGGAWLALRAEKERLQQQK 89

  Fly    71 RQRQLGKAAIG-GSWELVDSQGAVRKSEDFLGKWLLIYFGFTHCPDICPDELEKMAAVVDEVEKS 134
            |...|.:||:| |.:.|:|.:|..|...||.|:|:|:|||||||||||||||||:..||.::|..
Human    90 RTEALRQAAVGQGDFHLLDHRGRARCKADFRGQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAE 154

  Fly   135 PQTPAVQPIFITVDPERDSKEVVAKYVKEFSPKLLGLTGTVEQIRKVCKAFRVYFSAGPRDEDND 199
            |..|.|||:|||||||||..|.:|:||::|.|:||||||:.:|:.:...::|||::|||:|||.|
Human   155 PGLPPVQPVFITVDPERDDVEAMARYVQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQD 219

  Fly   200 YIVDHTIIMYLVNPDGEFVDYYGQNRDKDQCVASILVNIAKWNSM 244
            |||||:|.:||:||||.|.||||::|..:|...|:..::|.:.|:
Human   220 YIVDHSIAIYLLNPDGLFTDYYGRSRSAEQISDSVRRHMAAFRSV 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScoxNP_608884.1 SCO1-SenC 81..217 CDD:396962 80/136 (59%)
SCO2NP_001162580.1 SCO 101..242 CDD:239266 82/140 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147991
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1999
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG51910
OrthoDB 1 1.010 - - D1462537at2759
OrthoFinder 1 1.000 - - FOG0002408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100983
Panther 1 1.100 - - O PTHR12151
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1293
SonicParanoid 1 1.000 - - X1597
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.750

Return to query results.
Submit another query.