DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scox and HCC2

DIOPT Version :9

Sequence 1:NP_608884.1 Gene:Scox / 33711 FlyBaseID:FBgn0262467 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_568068.1 Gene:HCC2 / 830129 AraportID:AT4G39740 Length:276 Species:Arabidopsis thaliana


Alignment Length:278 Identity:89/278 - (32%)
Similarity:140/278 - (50%) Gaps:54/278 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QRLVGSCRRWAQQ------PAIR----HY------------AAPADSTKG--KGPISWRSLAVIG 46
            :|||.||:..|..      |:.|    :|            ..|...|.|  :.|...|:...:.
plant     5 RRLVLSCKNQAASFLRRCGPSKRIQSVNYCKSTRQGHEIPDVKPLFPTGGGTQAPSRSRARYAVP 69

  Fly    47 A--LG-AGGVGFMLYVKSEKDEARMKERQRQLGKAA-----------------IGGSWELVDSQG 91
            |  || ||.|||:.|    .||.|...|    |:|:                 |||.:.||.::.
plant    70 AILLGFAGFVGFLHY----NDERRAVPR----GQASSNSGCGCGSNTTVKGPIIGGPFTLVSTEN 126

  Fly    92 AVRKSEDFLGKWLLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPAVQPIFITVDPERDSKEV 156
            .:....||.|||:|:|||::..||:.|::|:.|:..||::| |.....:.|:|:|:||:||:...
plant   127 KIVTENDFCGKWVLLYFGYSFSPDVGPEQLKMMSKAVDKLE-SKHNEKILPVFVTLDPQRDTPSH 190

  Fly   157 VAKYVKEFSPKLLGLTGTVEQIRKVCKAFRVYFSAGPRDEDNDYIVDHTIIMYLVNPDGEFVDYY 221
            :..|:|||..::||||||...:|::.:.:||||.. .:::..||:||.:..|||:||..|.|..:
plant   191 LHAYLKEFDSRILGLTGTASAMRQMAQEYRVYFKK-VQEDGEDYLVDTSHNMYLINPKMEIVRCF 254

  Fly   222 GQNRDKDQCVASILVNIA 239
            |...:.|:....:|..:|
plant   255 GVEYNPDELSQELLKEVA 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScoxNP_608884.1 SCO1-SenC 81..217 CDD:396962 53/135 (39%)
HCC2NP_568068.1 SCO 115..255 CDD:239266 56/141 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG1999
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1462537at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100983
Panther 1 1.100 - - O PTHR12151
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.