DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scox and Sco1

DIOPT Version :9

Sequence 1:NP_608884.1 Gene:Scox / 33711 FlyBaseID:FBgn0262467 Length:251 Species:Drosophila melanogaster
Sequence 2:NP_001035115.1 Gene:Sco1 / 52892 MGIID:106362 Length:284 Species:Mus musculus


Alignment Length:213 Identity:118/213 - (55%)
Similarity:156/213 - (73%) Gaps:2/213 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GPISWRSLAVIGALGAGGVGFMLYVKSEKDEARMKERQRQLGKAAIGGSWELVDSQGAVRKSEDF 99
            ||:||:|||:..|:|...:..|.|.|.||.|...|:|.|.:||..:||.:.|....|..:..:|:
Mouse    74 GPVSWKSLALTFAIGGSLLAGMKYFKKEKIEKLEKQRHRSIGKPLLGGPFSLTTHNGEPKTDKDY 138

  Fly   100 LGKWLLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPAVQPIFITVDPERDSKEVVAKYVKEF 164
            ||:|:||||||||||||||:|||||..||:|::..|..|.:.|:|||:|||||:||.:|.|||||
Mouse   139 LGQWVLIYFGFTHCPDICPEELEKMIEVVEEIDSIPSLPNLTPLFITIDPERDTKEAIATYVKEF 203

  Fly   165 SPKLLGLTGTVEQIRKVCKAFRVYFSAGPRDEDNDYIVDHTIIMYLVNPDGEFVDYYGQNRDKDQ 229
            ||||:|||||.|:|..|.:|:|||:|.||:|||.||||||||||||:.|||||:||:|||:.|.:
Mouse   204 SPKLVGLTGTKEEIDGVARAYRVYYSPGPKDEDEDYIVDHTIIMYLIGPDGEFLDYFGQNKKKAE 268

  Fly   230 CVASILVNIAKWNSMNKK 247
            ...||..::.  :.|.|:
Mouse   269 IAGSIAAHMR--SHMKKR 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScoxNP_608884.1 SCO1-SenC 81..217 CDD:396962 86/135 (64%)
Sco1NP_001035115.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 46..73
Important for dimerization. /evidence=ECO:0000250 101..114 6/12 (50%)
SCO 119..261 CDD:239266 90/141 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838082
Domainoid 1 1.000 200 1.000 Domainoid score I3047
eggNOG 1 0.900 - - E1_COG1999
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H3374
Inparanoid 1 1.050 257 1.000 Inparanoid score I3139
Isobase 1 0.950 - 0 Normalized mean entropy S1273
OMA 1 1.010 - - QHG51910
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002408
OrthoInspector 1 1.000 - - oto92800
orthoMCL 1 0.900 - - OOG6_100983
Panther 1 1.100 - - LDO PTHR12151
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1293
SonicParanoid 1 1.000 - - X1597
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1615.740

Return to query results.
Submit another query.