DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Scox and sco1

DIOPT Version :9

Sequence 1:NP_608884.1 Gene:Scox / 33711 FlyBaseID:FBgn0262467 Length:251 Species:Drosophila melanogaster
Sequence 2:XP_031750222.1 Gene:sco1 / 100494754 XenbaseID:XB-GENE-6084257 Length:278 Species:Xenopus tropicalis


Alignment Length:200 Identity:123/200 - (61%)
Similarity:158/200 - (79%) Gaps:0/200 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 GPISWRSLAVIGALGAGGVGFMLYVKSEKDEARMKERQRQLGKAAIGGSWELVDSQGAVRKSEDF 99
            ||:||:|||:..|||...:..|.|:|.||::...:||:|.|||..:||.:.|:|..|..:..:|:
 Frog    68 GPVSWKSLALTVALGGALMAGMKYLKKEKEDKLEQERKRSLGKPLLGGPFSLIDHNGQPKTDKDY 132

  Fly   100 LGKWLLIYFGFTHCPDICPDELEKMAAVVDEVEKSPQTPAVQPIFITVDPERDSKEVVAKYVKEF 164
            ||:|:|:||||||||||||:|:|||..||||::|.|..|.:.|:|||:|||||||:.||.|||||
 Frog   133 LGQWVLLYFGFTHCPDICPEEIEKMILVVDEIDKIPTLPNLTPLFITIDPERDSKDAVANYVKEF 197

  Fly   165 SPKLLGLTGTVEQIRKVCKAFRVYFSAGPRDEDNDYIVDHTIIMYLVNPDGEFVDYYGQNRDKDQ 229
            ||||:||||:.|||.||.||:|||||:||:||||||||||||||||:.|||.||||||||:...:
 Frog   198 SPKLIGLTGSSEQIEKVAKAYRVYFSSGPKDEDNDYIVDHTIIMYLLAPDGSFVDYYGQNKRNAE 262

  Fly   230 CVASI 234
            ..:||
 Frog   263 ISSSI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ScoxNP_608884.1 SCO1-SenC 81..217 CDD:396962 92/135 (68%)
sco1XP_031750222.1 SCO 113..255 CDD:239266 96/141 (68%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 212 1.000 Domainoid score I2730
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H3374
Inparanoid 1 1.050 271 1.000 Inparanoid score I2935
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1462537at2759
OrthoFinder 1 1.000 - - FOG0002408
OrthoInspector 1 1.000 - - oto103069
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1597
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.060

Return to query results.
Submit another query.