DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF3i and CG10459

DIOPT Version :9

Sequence 1:NP_523478.1 Gene:eIF3i / 33710 FlyBaseID:FBgn0015834 Length:326 Species:Drosophila melanogaster
Sequence 2:NP_610513.2 Gene:CG10459 / 36000 FlyBaseID:FBgn0033440 Length:322 Species:Drosophila melanogaster


Alignment Length:314 Identity:61/314 - (19%)
Similarity:122/314 - (38%) Gaps:33/314 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LMLQGHERSITQIKYNRE---GDLLFSCSKDQKPNVWYSLNGERLGTYDGHQGAVWCLDVDWESR 65
            ::..||..|:.::.:||:   |..|.|...|....:.:...|:.:.....|..:||.:.:..:::
  Fly     7 VLCPGHSDSVVELSFNRDYDTGYFLASAGLDGVAALRHGDTGDCITHLRKHTDSVWSVSLSHDAK 71

  Fly    66 KLITGAGDMTAKIWDVEYGTVIASIPTKSSVRTSNFSFSGNQAAYSTDKAMGQSCELFLIDVRNA 130
            .|.:|..|...::||...|..:..:....:|...:.:   .:|.......:.|...|.|.|:.. 
  Fly    72 ILASGGADCKVRVWDALLGKQLKKLRHTKTVACVDLN---PKATRLLTGCIDQESPLALFDMEQ- 132

  Fly   131 DSSLSEQEPTLRIPMTESKITSMLWGPLDETIITGHDNGNIAIWDIRKGQKVVDSGTDHSAGIND 195
                ||:.|.:........:..:::...:...::...:..:.:||.|.|.:.......|.  :..
  Fly   133 ----SEKAPLMEFRGHSRGVRDVIFCLEEHCFLSSSYDRTVRMWDCRTGTRTNSIFLPHH--VKS 191

  Fly   196 MQLSKDGTMFVTASKDTTAKLFDSESLMCLKTYKTERPVNSAAISPIMDHVVLGGGQDAMEVTTT 260
            ::|...|.: ||.:........|.:|...||..|....|.:|::||.....|.|....       
  Fly   192 LELHHSGDI-VTIAYAGGVIFLDPKSFEVLKHRKLPYKVTAASLSPNKGIYVCGNNMG------- 248

  Fly   261 STKAGKFDSRFFHLIYEEEFAR---LKGHFGPINSLAFHPDGKSYASGGEDGFV 311
              .:.|:|       |:.:..|   :......:.:|:|.|||:..|.|.:||.:
  Fly   249 --YSFKYD-------YDTDVDRGLYVSQEPSAVLALSFSPDGEVCAIGSQDGSI 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF3iNP_523478.1 WD40 6..313 CDD:295369 61/312 (20%)
WD40 <9..313 CDD:225201 60/309 (19%)
WD40 repeat 13..50 CDD:293791 7/39 (18%)
WD40 repeat 56..91 CDD:293791 7/34 (21%)
WD40 repeat 96..142 CDD:293791 9/45 (20%)
WD40 repeat 151..186 CDD:293791 4/34 (12%)
WD40 repeat 193..228 CDD:293791 8/34 (24%)
WD40 repeat 234..284 CDD:293791 10/52 (19%)
WD40 repeat 290..313 CDD:293791 9/22 (41%)
CG10459NP_610513.2 WD40 <10..322 CDD:225201 61/311 (20%)
WD40 11..297 CDD:295369 61/310 (20%)
WD40 repeat 61..97 CDD:293791 8/35 (23%)
WD40 repeat 103..143 CDD:293791 8/47 (17%)
WD40 repeat 148..185 CDD:293791 4/36 (11%)
WD40 repeat 190..222 CDD:293791 7/32 (22%)
WD40 repeat 229..264 CDD:293791 10/50 (20%)
WD40 repeat 272..298 CDD:293791 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.