DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment TNC and CG9500

DIOPT Version :9

Sequence 1:XP_016870167.1 Gene:TNC / 3371 HGNCID:5318 Length:2384 Species:Homo sapiens
Sequence 2:NP_609018.3 Gene:CG9500 / 33888 FlyBaseID:FBgn0031804 Length:292 Species:Drosophila melanogaster


Alignment Length:307 Identity:93/307 - (30%)
Similarity:142/307 - (46%) Gaps:44/307 - (14%)


- Green bases have known domain annotations that are detailed below.


Human  2072 SPRDLTATEVQSETALLTWRPPRASVTGYLLVYESVDGTVKEVIVGPDTTSYSLADLSPSTHYTA 2136
            |...:.:...|::||:.. :|...|:  |.||                   .:|.:.:.|...|.
  Fly    17 STEAMDSESFQNDTAIRN-KPELKSL--YKLV-------------------LALLEENQSNASTE 59

Human  2137 KIQALNGPLRSNMIQTIFTTIGLLYPFPKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTS 2201
            .||..:..|         .|.||...:|..|.    ......|:||:.:.|.|  ..:|.||...
  Fly    60 NIQKSSSDL---------NTTGLSGRYPSQCP----TYPPAHGIYTVQVLGLK--PFQVSCDAEI 109

Human  2202 DGGGWIVFLRRKNGRENFYQNWKAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRD-HGET 2265
            .|.||.|..||.:.:.||:::|..|..|||....:|::|||.|:.||....:||.:.|.| .|:|
  Fly   110 AGTGWTVMARRTSNKLNFFRSWAEYKNGFGQLDGDFFIGLDKLHAITKSQPHELYIHLEDFEGQT 174

Human  2266 AFAVYDKFSVGDAKTRYKL-KVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWY 2329
            .:|.||:..:......|.: |:..::|.|||||.::..::|||||:|.|....|||..|.||:|:
  Fly   175 RYAHYDEIFIESENKFYAMTKLGEFTGDAGDSMIHNRNQNFSTFDRDNDGWHKNCAEEYVGAWWH 239

Human  2330 RNCHRVNLMGRYGDNNHSQ-----GVNWFHWKGHEHSIQFAEMKLRP 2371
            .||...||.|.|...:..|     |:.|..|:...:|.:..:|.:||
  Fly   240 LNCTYSNLFGIYVKGDEGQYFQWKGIVWHSWRTESYSYKVMQMMVRP 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
TNCXP_016870167.1 EGF_2 377..403 CDD:285248
EGF_2 408..434 CDD:285248
EGF_2 468..496 CDD:285248
EGF_2 504..527 CDD:285248
EGF_2 533..558 CDD:285248
fn3 624..695 CDD:306538
fn3 713..793 CDD:306538
fn3 804..884 CDD:306538
fn3 894..976 CDD:306538
fn3 986..1064 CDD:306538
fn3 1075..1154 CDD:306538
fn3 1169..1241 CDD:306538
fn3 1260..1327 CDD:306538
fn3 1348..1427 CDD:306538
fn3 1439..1508 CDD:306538
fn3 1533..1605 CDD:306538
fn3 1619..1691 CDD:306538
fn3 1716..1788 CDD:306538
fn3 1804..1883 CDD:306538
fn3 1894..1973 CDD:306538
fn3 1985..2055 CDD:306538
fn3 2071..2143 CDD:306538 14/70 (20%)
Fibrinogen_C 2163..2372 CDD:278572 75/216 (35%)
CG9500NP_609018.3 FReD 76..287 CDD:238040 75/217 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2579
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100073
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.