DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Marcal1 and ERCC6

DIOPT Version :10

Sequence 1:NP_608883.1 Gene:Marcal1 / 33709 FlyBaseID:FBgn0031655 Length:755 Species:Drosophila melanogaster
Sequence 2:NP_000115.1 Gene:ERCC6 / 2074 HGNCID:3438 Length:1493 Species:Homo sapiens


Alignment Length:55 Identity:13/55 - (23%)
Similarity:27/55 - (49%) Gaps:11/55 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 DVKEAIRRLPEKLKDERNFRITRALHLSMTKTILPKEQWTKYEEDTKYLEPYLQE 95
            ::::::|.|.|:|.:......|:..||.:: :..|:          |.|.|.||:
Human    41 EMQDSVRNLSEQLPENCETYSTKFYHLGLS-SFTPR----------KLLAPELQK 84

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Marcal1NP_608883.1 HARP 160..216 CDD:462166
HepA <233..666 CDD:440319
DEXHc_HARP_SMARCAL1 247..456 CDD:350768
ERCC6NP_000115.1 N-terminal domain, essential for its chromatin remodeling activity. /evidence=ECO:0000269|PubMed:29203878 1..510 13/55 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..39
cc_ERCC-6_N 83..159 CDD:411064 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..323
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 344..453
HepA 391..987 CDD:440319
DEAH box. /evidence=ECO:0000255|PROSITE-ProRule:PRU00541 646..649
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1042..1147
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1181..1247
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1318..1384
CSA-interacting motif (CIM). /evidence=ECO:0000269|PubMed:32355176 1386..1398
Ubiquitin-binding domain (UBD). /evidence=ECO:0000269|PubMed:20541997 1400..1428
CSB_WHD 1420..1492 CDD:439329
Winged-helix domain (WHD). /evidence=ECO:0000305|PubMed:29203878 1429..1493
Essential for its interaction with RNA polymerase II, transcription-coupled nucleotide excision repair activity, association with chromatin after UV irradiation and for mediating the UV-induced translocation of ERRC8 to the nuclear matrix. /evidence=ECO:0000269|PubMed:26620705 1446..1493
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.