DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and PRSS27

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:250 Identity:80/250 - (32%)
Similarity:111/250 - (44%) Gaps:39/250 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 RIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTNGASQVTIY---YGATWRT 97
            |:|.|....||:.|:.|.:  ..||..:||||:||..||||||||....|:.::|   .||....
Human    34 RMVGGQDTQEGEWPWQVSI--QRNGSHFCGGSLIAEQWVLTAAHCFRNTSETSLYQVLLGARQLV 96

  Fly    98 ----NAQFTHT--VGSGDFIQNHNWPNQNGNDIALI--RTPHVDFWHMVNKVELPSFNDRYNMYD 154
                :|.:...  |.|....|.    ..:..|:||:  ..| |.|.:.:..|.||..:..:....
Human    97 QPGPHAMYARVRQVESNPLYQG----TASSADVALVELEAP-VPFTNYILPVCLPDPSVIFETGM 156

  Fly   155 NYWAVACGWGLTTAGS---QPDWMECVDLQIISNSECSRTY------GTQP----DGILCVS-TS 205
            |.|..  |||..:...   :|..::.:.:.||...:|:..|      |.||    :.:||.. ..
Human   157 NCWVT--GWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKTIKNDMLCAGFEE 219

  Fly   206 GGKSTCSGDSGGPLVLHDGGRLV--GVTSWVSGNGCT-AGLPSGFTRVTNQLDWI 257
            |.|..|.||||||||...|...:  ||.||  |.||. ...|..:.|||...:||
Human   220 GKKDACKGDSGGPLVCLVGQSWLQAGVISW--GEGCARQNRPGVYIRVTAHHNWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 78/248 (31%)
Tryp_SPc 37..260 CDD:238113 78/248 (31%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 78/248 (31%)
Tryp_SPc 36..275 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.