DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and Prss8

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_579929.1 Gene:Prss8 / 76560 MGIID:1923810 Length:339 Species:Mus musculus


Alignment Length:256 Identity:77/256 - (30%)
Similarity:109/256 - (42%) Gaps:46/256 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 INGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHC------------TNGAS 85
            |..||..|..|..|:.|:.|.:.:.||  ..||||::::.||::||||            ..||.
Mouse    41 IQPRITGGGSAKPGQWPWQVSITYDGN--HVCGGSLVSNKWVVSAAHCFPREHSREAYEVKLGAH 103

  Fly    86 QVTIYYGATWRTNAQFTHTVGSGDFIQNHNWPNQNGN--DIALIR-TPHVDFWHMVNKVELPSFN 147
            |:..|      :|....|||..   |..|:...:.|:  |||||| :..|.|...:..:.||:.|
Mouse   104 QLDSY------SNDTVVHTVAQ---IITHSSYREEGSQGDIALIRLSSPVTFSRYIRPICLPAAN 159

  Fly   148 DRYNMYDNYWAVACGWGLTTAG---SQPDWMECVDLQIISNSECSRTYG---------TQPDGIL 200
            ..:.  :.......|||.....   ..|..::.:::.:||...||..|.         |....:|
Mouse   160 ASFP--NGLHCTVTGWGHVAPSVSLQTPRPLQQLEVPLISRETCSCLYNINAVPEEPHTIQQDML 222

  Fly   201 CVS-TSGGKSTCSGDSGGPLVLHDGG--RLVGVTSWVSGNGCTA-GLPSGFTRVTNQLDWI 257
            |.. ..|||..|.|||||||.....|  .|.|:.||  |:.|.| ..|..:|..:....||
Mouse   223 CAGYVKGGKDACQGDSGGPLSCPMEGIWYLAGIVSW--GDACGAPNRPGVYTLTSTYASWI 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 74/251 (29%)
Tryp_SPc 37..260 CDD:238113 75/252 (30%)
Prss8NP_579929.1 Tryp_SPc 45..284 CDD:238113 75/252 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.