DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and Prss41

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_036016678.1 Gene:Prss41 / 71003 MGIID:1918253 Length:353 Species:Mus musculus


Alignment Length:266 Identity:75/266 - (28%)
Similarity:114/266 - (42%) Gaps:62/266 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSIIAHDWVLTAAHCTN---GASQVTIYY 91
            ||:  .|||.|..:.:|:.|:...|....:..  ||||:::..||||||||..   ...:.|:..
Mouse    79 DTR--SRIVGGIESMQGRWPWQASLRLKKSHR--CGGSLLSRRWVLTAAHCFRKYLDPEKWTVQL 139

  Fly    92 G------ATWRTNAQFTH------TVGSGDFIQNHNWPNQNGNDIALIR-TPHVDFWHMVNK--- 140
            |      :.|...|....      .|.|.|.:::|        |:||:| ...|.:    ||   
Mouse   140 GQLTSKPSYWNRKAYSGRYRVKDIIVNSEDKLKSH--------DLALLRLASSVTY----NKDIQ 192

  Fly   141 ---VELPSFNDRYNMYDNYWAVACGWGLTTAGSQ----PDWMECVDLQIISNSECSRTYG----- 193
               |:..:|..::.  ...|..  |||:.....:    |..:..|.:.|::||.|...:.     
Mouse   193 PVCVQPSTFTSQHQ--PRCWVT--GWGVLQEDLKPLPPPYHLREVQVSILNNSRCQELFEIFSLH 253

  Fly   194 ---TQPDGILCVSTSGGKS-TCSGDSGGPLVLHDGG--RLVGVTSWVSGNGC-TAGLPSGFTRVT 251
               |:  .:.|.....|.: |||||||||||.:..|  ..:|:.||  |.|| ...||..:|.|:
Mouse   254 HLITK--DVFCAGAEDGSADTCSGDSGGPLVCNMDGLWYQIGIVSW--GIGCGRPNLPGIYTNVS 314

  Fly   252 NQLDWI 257
            :..:||
Mouse   315 HYYNWI 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 71/258 (28%)
Tryp_SPc 37..260 CDD:238113 72/259 (28%)
Prss41XP_036016678.1 Tryp_SPc 84..321 CDD:238113 72/259 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.