DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and Prss22

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:278 Identity:80/278 - (28%)
Similarity:129/278 - (46%) Gaps:32/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 VFVVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGS 67
            :.:||..:.|.:||.|: :|.| |..|..::| |||.|..:.:.:.|:.|.:  ..||...|.||
Mouse    77 ILLVLLTSTAPISAATI-RVSP-DCGKPQQLN-RIVGGEDSMDAQWPWIVSI--LKNGSHHCAGS 136

  Fly    68 IIAHDWVLTAAHC----TNGASQVTIYYGATWRTNA--QFTHTVGSGDFIQN--HNWPNQNGNDI 124
            ::.:.||:|||||    .:..|..::..|| |:..:  ..:..||....:.:  ::|......||
Mouse   137 LLTNRWVVTAAHCFKSNMDKPSLFSVLLGA-WKLGSPGPRSQKVGIAWVLPHPRYSWKEGTHADI 200

  Fly   125 ALIRTPH-VDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAG---SQPDWMECVDLQIISN 185
            ||:|..| :.|...:..:.||..:.|.....:.|  ..|||....|   ..|..::.:.:.||.:
Mouse   201 ALVRLEHSIQFSERILPICLPDSSVRLPPKTDCW--IAGWGSIQDGVPLPHPQTLQKLKVPIIDS 263

  Fly   186 SECSRTY----GTQ--PDGILCVS-TSGGKSTCSGDSGGPLV--LHDGGRLVGVTSWVSGNGCT- 240
            ..|...|    |.:  .:|:||.. ..|.:..|.|||||||:  :.|...|.|:.||  |.||. 
Mouse   264 ELCKSLYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISW--GEGCAE 326

  Fly   241 AGLPSGFTRVTNQLDWIR 258
            ...|..:|.:.....|::
Mouse   327 RNRPGVYTSLLAHRSWVQ 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 68/242 (28%)
Tryp_SPc 37..260 CDD:238113 68/244 (28%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 68/244 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.