DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and PRSS22

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:276 Identity:73/276 - (26%)
Similarity:117/276 - (42%) Gaps:34/276 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWWCGGSII 69
            ::|..:.|.::|..:..  |....|..::| |:|.|..:.:.:.|:.|.:  ..||...|.||::
Human    21 LLLLASTAILNAARIPV--PPACGKPQQLN-RVVGGEDSTDSEWPWIVSI--QKNGTHHCAGSLL 80

  Fly    70 AHDWVLTAAHC----TNGASQVTIYYGATWRTN--AQFTHTVGSGDFIQNH---NWPNQNGNDIA 125
            ...||:|||||    .|.....::..|| |:..  ...:..||.. :::.|   :|......|||
Human    81 TSRWVITAAHCFKDNLNKPYLFSVLLGA-WQLGNPGSRSQKVGVA-WVEPHPVYSWKEGACADIA 143

  Fly   126 LIRTPH-VDFWHMVNKVELPSFNDRYNMYDNYWAVACGWGLTTAG---SQPDWMECVDLQIISNS 186
            |:|... :.|...|..:.||..:.......:.|  ..|||....|   ..|..::.:.:.||.:.
Human   144 LVRLERSIQFSERVLPICLPDASIHLPPNTHCW--ISGWGSIQDGVPLPHPQTLQKLKVPIIDSE 206

  Fly   187 ECSRTY------GTQPDGILCVS-TSGGKSTCSGDSGGPLVLHDGGR--LVGVTSWVSGNGCT-A 241
            .||..|      |...:.:||.. ..|.:..|.|||||||:....|.  |.|:.||  |.||. .
Human   207 VCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMCQVDGAWLLAGIISW--GEGCAER 269

  Fly   242 GLPSGFTRVTNQLDWI 257
            ..|..:..::....|:
Human   270 NRPGVYISLSAHRSWV 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 66/243 (27%)
Tryp_SPc 37..260 CDD:238113 66/244 (27%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 66/244 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.