DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon25Bi and cela2a

DIOPT Version :9

Sequence 1:NP_001033873.1 Gene:Jon25Bi / 33708 FlyBaseID:FBgn0020906 Length:266 Species:Drosophila melanogaster
Sequence 2:XP_017945752.1 Gene:cela2a / 594883 XenbaseID:XB-GENE-970278 Length:269 Species:Xenopus tropicalis


Alignment Length:276 Identity:86/276 - (31%)
Similarity:124/276 - (44%) Gaps:33/276 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKVFVVLALALAAVSAETVQQVHPKDLPKDTKINGRIVNGYPAYEGKAPYTVGLGFSGNGGWW-- 63
            |...:||.|.||......|....|        :..|:|||........|:.|.|.:...|.|:  
 Frog     1 MTPLLVLVLCLAGAYCCGVPTYQP--------VVSRVVNGEDVAPHSWPWQVSLQYLYYGYWYHT 57

  Fly    64 CGGSIIAHDWVLTAAHCTNGASQVTIYYGATWRTNAQFTH----TVGSGDFIQNHNW-PNQ--NG 121
            ||||:|:.:||||||||.:..:...:..|   :.|.::..    .:.....|.:..| ||.  ||
 Frog    58 CGGSLISSNWVLTAAHCISSYNTYRVQLG---KHNLRYIEPGQKIINVSKLINHPRWDPNSLGNG 119

  Fly   122 NDIALIRTPH-VDFWHMVNKVELPSFNDRYNMYDNYWAVACGWG-LTTAGSQPDWMECVDLQIIS 184
            .||:||:... |||...|....||...  |.:...|.....||| :.|.|.:||.::...|.::.
 Frog   120 FDISLIKLEESVDFSDTVQPACLPPAG--YILPHQYGCYVTGWGNIRTGGPEPDILQQGLLLVVD 182

  Fly   185 NSECSRTYGTQPDGI----LCVSTSGGKSTCSGDSGGPLVLHDGG---RLVGVTSWVSGNGCT-A 241
            .:.||: :....||:    :|....|..|:|:|||||||...:..   .:.||.|:.|..||. .
 Frog   183 YATCSQ-WDWWGDGVRTNMICAGGDGITSSCNGDSGGPLNCRNANGTWEVHGVVSFGSAAGCNYP 246

  Fly   242 GLPSGFTRVTNQLDWI 257
            ..||.|:||:....||
 Frog   247 KKPSVFSRVSEFNSWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon25BiNP_001033873.1 Tryp_SPc 36..257 CDD:214473 76/239 (32%)
Tryp_SPc 37..260 CDD:238113 77/240 (32%)
cela2aXP_017945752.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.